Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369H0Q5

Protein Details
Accession A0A369H0Q5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-38QGTAARPSRRRPAAPRRARQRASKILTHydrophilic
NLS Segment(s)
PositionSequence
17-33RPSRRRPAAPRRARQRA
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
Pfam View protein in Pfam  
PF13919  ASXH  
Amino Acid Sequences MASSPQPSAQAQGTAARPSRRRPAAPRRARQRASKILTSTTSPLAQADLRSILSNPLAWTALDATDRAEILALFPDRQHIIESGPESRPNFATLMSDDSFRYDCAAYTTNLGAGRHDEEWLADAWAAHERRKAGDFDTYLENKFADEWLADQESEPSTPSQATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.36
4 0.38
5 0.43
6 0.52
7 0.54
8 0.59
9 0.63
10 0.7
11 0.73
12 0.8
13 0.84
14 0.84
15 0.87
16 0.86
17 0.84
18 0.83
19 0.82
20 0.77
21 0.73
22 0.65
23 0.58
24 0.55
25 0.48
26 0.41
27 0.33
28 0.27
29 0.21
30 0.19
31 0.17
32 0.16
33 0.13
34 0.12
35 0.11
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.09
46 0.09
47 0.08
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.08
59 0.07
60 0.07
61 0.07
62 0.09
63 0.09
64 0.1
65 0.1
66 0.08
67 0.08
68 0.1
69 0.11
70 0.12
71 0.13
72 0.15
73 0.15
74 0.16
75 0.16
76 0.15
77 0.14
78 0.11
79 0.12
80 0.1
81 0.14
82 0.13
83 0.14
84 0.12
85 0.14
86 0.14
87 0.13
88 0.13
89 0.09
90 0.09
91 0.11
92 0.12
93 0.11
94 0.12
95 0.12
96 0.13
97 0.15
98 0.15
99 0.12
100 0.13
101 0.15
102 0.14
103 0.14
104 0.12
105 0.1
106 0.11
107 0.11
108 0.1
109 0.07
110 0.07
111 0.07
112 0.14
113 0.15
114 0.16
115 0.18
116 0.19
117 0.21
118 0.24
119 0.25
120 0.2
121 0.26
122 0.25
123 0.26
124 0.32
125 0.31
126 0.3
127 0.29
128 0.27
129 0.2
130 0.2
131 0.17
132 0.11
133 0.09
134 0.09
135 0.13
136 0.15
137 0.14
138 0.14
139 0.16
140 0.17
141 0.17
142 0.17
143 0.13
144 0.13