Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1DL63

Protein Details
Accession A1DL63    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-44VKSATPKVEKQEKKKEPKGRALKRLKYTRRFBasic
NLS Segment(s)
PositionSequence
10-43RAGKVKSATPKVEKQEKKKEPKGRALKRLKYTRR
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nfi:NFIA_048710  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSATPKVEKQEKKKEPKGRALKRLKYTRRFVNVTMTGGKRKVRSNPARYKGCIYALSGRVGFCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.39
4 0.41
5 0.44
6 0.51
7 0.55
8 0.63
9 0.66
10 0.67
11 0.72
12 0.75
13 0.79
14 0.81
15 0.82
16 0.79
17 0.82
18 0.84
19 0.81
20 0.82
21 0.82
22 0.8
23 0.8
24 0.83
25 0.81
26 0.78
27 0.75
28 0.72
29 0.69
30 0.64
31 0.56
32 0.54
33 0.48
34 0.42
35 0.41
36 0.36
37 0.32
38 0.32
39 0.34
40 0.29
41 0.32
42 0.37
43 0.43
44 0.52
45 0.59
46 0.67
47 0.73
48 0.76
49 0.74
50 0.72
51 0.65
52 0.59
53 0.5
54 0.43
55 0.42
56 0.38
57 0.39
58 0.35