Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GSM1

Protein Details
Accession A0A369GSM1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61LSLFVYRLIQKRKERKPSNFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, E.R. 6, mito 3, cyto 3, vacu 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVISTVSDIVKRAPHEHNWAYREPGVVLVFCIVFLVAVGVLSLFVYRLIQKRKERKPSNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.37
4 0.42
5 0.47
6 0.46
7 0.46
8 0.44
9 0.4
10 0.36
11 0.28
12 0.25
13 0.18
14 0.14
15 0.13
16 0.1
17 0.08
18 0.07
19 0.07
20 0.04
21 0.03
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.08
35 0.16
36 0.23
37 0.32
38 0.42
39 0.53
40 0.63
41 0.73