Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369GI98

Protein Details
Accession A0A369GI98    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-73RLRSKNGRKILARRRAKGRRELGBasic
NLS Segment(s)
PositionSequence
43-72KRRHGFLNRLRSKNGRKILARRRAKGRREL
Subcellular Location(s) nucl 16, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSDSLCADVVPSSAVSSHPALASQQLRFGPRNTMVRATRLVQKRRHGFLNRLRSKNGRKILARRRAKGRRELGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.11
4 0.12
5 0.11
6 0.11
7 0.11
8 0.16
9 0.19
10 0.16
11 0.19
12 0.2
13 0.23
14 0.24
15 0.25
16 0.24
17 0.26
18 0.3
19 0.28
20 0.32
21 0.3
22 0.31
23 0.32
24 0.29
25 0.31
26 0.34
27 0.4
28 0.4
29 0.48
30 0.52
31 0.53
32 0.59
33 0.56
34 0.57
35 0.6
36 0.65
37 0.65
38 0.62
39 0.63
40 0.63
41 0.67
42 0.68
43 0.66
44 0.63
45 0.61
46 0.68
47 0.75
48 0.77
49 0.78
50 0.77
51 0.8
52 0.82
53 0.82
54 0.82
55 0.79