Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GLS7

Protein Details
Accession A0A369GLS7   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-33IPTSADPRSKRPTKKRALSPTSSQAHydrophilic
123-152KEERDRRDQDKTRRNREKREKAKARKAAVVBasic
NLS Segment(s)
PositionSequence
19-20RP
22-22K
126-153RDRRDQDKTRRNREKREKAKARKAAVVK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSGEGPDSIPTSADPRSKRPTKKRALSPTSSQAASVTALFAKPDREIRVPPPATGPSSSLQRAASSRRPPPEIISNVQGSSAGAGSGEFHVYKASRRREYERLRDMDADLQRQRDQEGFARDKEERDRRDQDKTRRNREKREKAKARKAAVVKRAVDNHPSPVNTAVKDGVAGRAAHANGPRASQPHPSDNLDRVDQPATVPATVPATVPATGLVIHDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.34
3 0.44
4 0.53
5 0.62
6 0.7
7 0.75
8 0.8
9 0.86
10 0.89
11 0.9
12 0.89
13 0.85
14 0.81
15 0.79
16 0.72
17 0.62
18 0.52
19 0.41
20 0.33
21 0.27
22 0.2
23 0.13
24 0.09
25 0.09
26 0.1
27 0.1
28 0.11
29 0.12
30 0.17
31 0.21
32 0.24
33 0.27
34 0.31
35 0.4
36 0.4
37 0.38
38 0.37
39 0.35
40 0.34
41 0.32
42 0.3
43 0.23
44 0.26
45 0.26
46 0.24
47 0.21
48 0.21
49 0.22
50 0.26
51 0.31
52 0.34
53 0.39
54 0.42
55 0.45
56 0.44
57 0.45
58 0.48
59 0.44
60 0.4
61 0.37
62 0.34
63 0.31
64 0.3
65 0.25
66 0.16
67 0.13
68 0.09
69 0.05
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.05
76 0.05
77 0.07
78 0.07
79 0.12
80 0.2
81 0.27
82 0.31
83 0.35
84 0.42
85 0.5
86 0.58
87 0.63
88 0.63
89 0.59
90 0.55
91 0.52
92 0.47
93 0.43
94 0.37
95 0.32
96 0.25
97 0.25
98 0.24
99 0.23
100 0.23
101 0.18
102 0.18
103 0.17
104 0.22
105 0.23
106 0.22
107 0.25
108 0.25
109 0.26
110 0.33
111 0.36
112 0.33
113 0.38
114 0.45
115 0.45
116 0.54
117 0.61
118 0.63
119 0.65
120 0.71
121 0.75
122 0.78
123 0.82
124 0.83
125 0.86
126 0.87
127 0.88
128 0.89
129 0.89
130 0.88
131 0.92
132 0.89
133 0.82
134 0.78
135 0.75
136 0.72
137 0.68
138 0.65
139 0.57
140 0.54
141 0.55
142 0.5
143 0.48
144 0.41
145 0.39
146 0.35
147 0.33
148 0.29
149 0.29
150 0.3
151 0.25
152 0.25
153 0.2
154 0.17
155 0.17
156 0.16
157 0.13
158 0.13
159 0.12
160 0.12
161 0.15
162 0.15
163 0.17
164 0.19
165 0.22
166 0.2
167 0.22
168 0.24
169 0.22
170 0.25
171 0.3
172 0.33
173 0.35
174 0.39
175 0.42
176 0.44
177 0.46
178 0.47
179 0.41
180 0.38
181 0.34
182 0.31
183 0.26
184 0.22
185 0.23
186 0.2
187 0.18
188 0.17
189 0.16
190 0.17
191 0.17
192 0.17
193 0.14
194 0.14
195 0.14
196 0.14
197 0.13
198 0.11
199 0.11
200 0.11
201 0.11