Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CXA4

Protein Details
Accession A1CXA4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-63GDAPPPPGKKPTRRKRPDKAKKKEEKKNEDEAEBasic
NLS Segment(s)
PositionSequence
35-68PPPGKKPTRRKRPDKAKKKEEKKNEDEAERGEKK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, cyto 7, cyto_mito 6.833, mito 5.5
Family & Domain DBs
KEGG nfi:NFIA_107480  -  
Amino Acid Sequences MPAVWKLPHRGMLANFDGHAITISAHTPSAGDAPPPPGKKPTRRKRPDKAKKKEEKKNEDEAERGEKKGEAEGDKPSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.25
4 0.22
5 0.17
6 0.16
7 0.09
8 0.07
9 0.06
10 0.07
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.08
17 0.08
18 0.08
19 0.08
20 0.13
21 0.18
22 0.2
23 0.2
24 0.25
25 0.31
26 0.4
27 0.51
28 0.57
29 0.63
30 0.72
31 0.8
32 0.84
33 0.9
34 0.91
35 0.92
36 0.92
37 0.92
38 0.92
39 0.93
40 0.92
41 0.91
42 0.9
43 0.86
44 0.85
45 0.8
46 0.72
47 0.64
48 0.59
49 0.57
50 0.5
51 0.43
52 0.34
53 0.3
54 0.28
55 0.3
56 0.31
57 0.25
58 0.25
59 0.31