Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369GMF8

Protein Details
Accession A0A369GMF8    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-93DDAFQPRAKPKRRAGNSLKRRRBasic
NLS Segment(s)
PositionSequence
78-93RAKPKRRAGNSLKRRR
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MPGRKALIASEAPMALSSVNNGATAGSESWTSAQLAWTQDVQRRLTALEKSRAAVAAATASAIAVDDDDDDDDAFQPRAKPKRRAGNSLKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.09
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.09
12 0.08
13 0.07
14 0.07
15 0.07
16 0.08
17 0.09
18 0.09
19 0.07
20 0.08
21 0.1
22 0.11
23 0.12
24 0.13
25 0.14
26 0.17
27 0.21
28 0.21
29 0.19
30 0.18
31 0.18
32 0.19
33 0.21
34 0.22
35 0.23
36 0.23
37 0.23
38 0.23
39 0.22
40 0.19
41 0.15
42 0.11
43 0.06
44 0.06
45 0.05
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.02
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.08
61 0.08
62 0.1
63 0.13
64 0.21
65 0.31
66 0.39
67 0.48
68 0.55
69 0.66
70 0.72
71 0.79
72 0.81
73 0.83