Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GJ81

Protein Details
Accession A0A369GJ81   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-31ILQQALQRLRRNHRHPNACSHydrophilic
101-121LDPKHRKKTLRSSLPKYCRVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014810  Fcf2_C  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MAELLDQTTDAILQQALQRLRRNHRHPNACSSIPSTGKLSLAGRTDPPTDPSLNIRRPLSNPSQKDAVEDTAGPGWFFLRKTKVTPNLKRYWQLLSVRGLLDPKHRKKTLRSSLPKYCRVAEVTSGFRSSTGKKLLRQKENQILNDQMSDRKSKKLAKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.16
3 0.2
4 0.26
5 0.33
6 0.4
7 0.5
8 0.59
9 0.65
10 0.7
11 0.76
12 0.81
13 0.78
14 0.8
15 0.76
16 0.68
17 0.62
18 0.54
19 0.5
20 0.41
21 0.39
22 0.31
23 0.26
24 0.24
25 0.24
26 0.22
27 0.2
28 0.2
29 0.2
30 0.19
31 0.21
32 0.23
33 0.22
34 0.23
35 0.22
36 0.21
37 0.21
38 0.25
39 0.31
40 0.32
41 0.35
42 0.34
43 0.33
44 0.34
45 0.39
46 0.42
47 0.43
48 0.41
49 0.4
50 0.42
51 0.4
52 0.4
53 0.36
54 0.28
55 0.2
56 0.18
57 0.15
58 0.13
59 0.13
60 0.11
61 0.08
62 0.07
63 0.08
64 0.08
65 0.1
66 0.12
67 0.14
68 0.17
69 0.24
70 0.33
71 0.42
72 0.49
73 0.54
74 0.57
75 0.59
76 0.59
77 0.54
78 0.48
79 0.45
80 0.39
81 0.35
82 0.31
83 0.3
84 0.27
85 0.26
86 0.24
87 0.18
88 0.25
89 0.32
90 0.37
91 0.44
92 0.47
93 0.5
94 0.57
95 0.68
96 0.69
97 0.7
98 0.72
99 0.71
100 0.78
101 0.82
102 0.81
103 0.73
104 0.64
105 0.56
106 0.49
107 0.43
108 0.38
109 0.35
110 0.32
111 0.31
112 0.3
113 0.26
114 0.24
115 0.25
116 0.22
117 0.25
118 0.29
119 0.32
120 0.38
121 0.48
122 0.58
123 0.65
124 0.7
125 0.72
126 0.73
127 0.77
128 0.73
129 0.68
130 0.62
131 0.54
132 0.5
133 0.42
134 0.37
135 0.32
136 0.37
137 0.34
138 0.36
139 0.42
140 0.47