Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GI01

Protein Details
Accession A0A369GI01    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-142ATTFVKPKKATPRKRKAATAKLVHydrophilic
154-181EKTPKKAVATPRKRKAKKAPVSEEKIQLHydrophilic
NLS Segment(s)
PositionSequence
125-137KPKKATPRKRKAA
155-172KTPKKAVATPRKRKAKKA
Subcellular Location(s) cyto 20.5, cyto_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MGNGDKKWDATAERDLCISLIMSISKEGKTGYNWPQVTTSMEALGHTFTKDAMSQHFSKVICKDYKNRRGEIPPVAGVGGGESTPLKNKKKMTTAAKMILGVVDSDDDEGVKAEEYDDDATTFVKPKKATPRKRKAATAKLVADDGGDVDGAAEKTPKKAVATPRKRKAKKAPVSEEKIQLSPAAESEEEVDKVSIVKTEATVDGTESNETSTDGAEGGDAMAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.27
4 0.25
5 0.2
6 0.1
7 0.09
8 0.09
9 0.09
10 0.12
11 0.14
12 0.13
13 0.14
14 0.14
15 0.15
16 0.18
17 0.25
18 0.3
19 0.37
20 0.37
21 0.38
22 0.39
23 0.38
24 0.38
25 0.33
26 0.26
27 0.18
28 0.17
29 0.16
30 0.15
31 0.15
32 0.13
33 0.1
34 0.09
35 0.08
36 0.09
37 0.1
38 0.11
39 0.13
40 0.18
41 0.19
42 0.21
43 0.25
44 0.24
45 0.26
46 0.28
47 0.31
48 0.31
49 0.33
50 0.41
51 0.48
52 0.58
53 0.59
54 0.59
55 0.57
56 0.57
57 0.59
58 0.55
59 0.48
60 0.39
61 0.34
62 0.31
63 0.26
64 0.2
65 0.15
66 0.09
67 0.05
68 0.04
69 0.04
70 0.05
71 0.1
72 0.17
73 0.2
74 0.25
75 0.3
76 0.35
77 0.41
78 0.49
79 0.51
80 0.53
81 0.55
82 0.53
83 0.5
84 0.44
85 0.37
86 0.29
87 0.22
88 0.14
89 0.08
90 0.05
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.05
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.07
109 0.11
110 0.11
111 0.14
112 0.14
113 0.2
114 0.31
115 0.41
116 0.52
117 0.6
118 0.69
119 0.75
120 0.8
121 0.83
122 0.82
123 0.81
124 0.77
125 0.74
126 0.65
127 0.56
128 0.51
129 0.42
130 0.32
131 0.22
132 0.15
133 0.07
134 0.05
135 0.04
136 0.03
137 0.05
138 0.05
139 0.05
140 0.07
141 0.07
142 0.09
143 0.11
144 0.13
145 0.13
146 0.19
147 0.29
148 0.39
149 0.5
150 0.59
151 0.68
152 0.77
153 0.8
154 0.84
155 0.84
156 0.84
157 0.82
158 0.83
159 0.83
160 0.82
161 0.85
162 0.81
163 0.76
164 0.68
165 0.59
166 0.49
167 0.39
168 0.3
169 0.23
170 0.18
171 0.15
172 0.12
173 0.11
174 0.13
175 0.15
176 0.14
177 0.15
178 0.14
179 0.11
180 0.12
181 0.12
182 0.11
183 0.09
184 0.1
185 0.1
186 0.12
187 0.13
188 0.14
189 0.14
190 0.14
191 0.15
192 0.15
193 0.16
194 0.14
195 0.13
196 0.12
197 0.12
198 0.11
199 0.1
200 0.09
201 0.08
202 0.07
203 0.07
204 0.06