Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D5G4

Protein Details
Accession A1D5G4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
135-157SPAQAPRRSGRARRPPQRYVPEAHydrophilic
NLS Segment(s)
PositionSequence
142-148RSGRARR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
KEGG nfi:NFIA_023870  -  
Amino Acid Sequences MLQRKQVPFEVSPDSPALVVFEIWDQAIAPAILLRLINQDQSNSDRECSICHGTSAEDTVYLKCEQYRTDIHLQCMESWLKAWSTSINFDCLICREHQWFDVIYSAPVATRRRRTAPKSPEETITVSMEVASGESPAQAPRRSGRARRPPQRYVPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.21
4 0.18
5 0.11
6 0.1
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.06
13 0.06
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.06
20 0.06
21 0.07
22 0.1
23 0.11
24 0.14
25 0.14
26 0.15
27 0.16
28 0.2
29 0.23
30 0.2
31 0.2
32 0.18
33 0.18
34 0.18
35 0.21
36 0.22
37 0.18
38 0.18
39 0.17
40 0.17
41 0.17
42 0.17
43 0.12
44 0.09
45 0.09
46 0.09
47 0.11
48 0.1
49 0.1
50 0.1
51 0.11
52 0.11
53 0.14
54 0.16
55 0.19
56 0.28
57 0.29
58 0.3
59 0.32
60 0.32
61 0.28
62 0.28
63 0.23
64 0.14
65 0.13
66 0.12
67 0.09
68 0.08
69 0.09
70 0.08
71 0.09
72 0.13
73 0.13
74 0.14
75 0.14
76 0.14
77 0.14
78 0.13
79 0.14
80 0.11
81 0.13
82 0.13
83 0.14
84 0.15
85 0.16
86 0.15
87 0.14
88 0.16
89 0.14
90 0.11
91 0.11
92 0.1
93 0.09
94 0.13
95 0.17
96 0.21
97 0.28
98 0.33
99 0.4
100 0.49
101 0.56
102 0.62
103 0.68
104 0.71
105 0.7
106 0.68
107 0.63
108 0.58
109 0.53
110 0.45
111 0.37
112 0.27
113 0.2
114 0.18
115 0.15
116 0.11
117 0.09
118 0.07
119 0.05
120 0.05
121 0.05
122 0.06
123 0.1
124 0.15
125 0.17
126 0.2
127 0.24
128 0.33
129 0.41
130 0.49
131 0.57
132 0.63
133 0.72
134 0.79
135 0.84
136 0.84
137 0.86