Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A369GD22

Protein Details
Accession A0A369GD22    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-88MIRSNRKKASKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
73-88NRKKASKAKAAAKKKA
Subcellular Location(s) plas 20, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences LDKLLGLAMLVAASVVFIYYSVWTLLMPFVDDDHPLQNFFLPRVWAIRIPVILVLLASAVVGSFLGTVMIRSNRKKASKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.04
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.06
15 0.06
16 0.07
17 0.07
18 0.08
19 0.09
20 0.11
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.09
29 0.09
30 0.11
31 0.12
32 0.11
33 0.12
34 0.12
35 0.11
36 0.11
37 0.11
38 0.09
39 0.08
40 0.06
41 0.05
42 0.03
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.04
55 0.07
56 0.13
57 0.19
58 0.23
59 0.3
60 0.38
61 0.43
62 0.51
63 0.57
64 0.62
65 0.67
66 0.72
67 0.76
68 0.78