FuNGI

A0A369H0P9

Protein Details

Accession

A0A369H0P9

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
342-366	MLSGPGKKKTAQRGRRRRGLDKGGS	Basic

NLS Segment(s)

Position	Sequence
346-361	PGKKKTAQRGRRRRGL

Subcellular Location(s)

cyto_nucl 10, nucl 9, cyto 9, pero 7

Family & Domain DBs

InterPro	View protein in InterPro IPR001487 Bromodomain IPR036427 Bromodomain-like_sf IPR000210 BTB/POZ_dom IPR011333 SKP1/BTB/POZ_sf
Pfam	View protein in Pfam PF00439 Bromodomain
PROSITE	View protein in PROSITE PS50014 BROMODOMAIN_2 PS50097 BTB
CDD	cd18186 BTB_POZ_ZBTB_KLHL-like

Amino Acid Sequences

MQQRQEGADEGASPGTSSPTKEATAVKPQFSWLQPHPIFVILLIGPEEQPFGIQKDFLCHRSEFYRQYFDSQGASETVEHLVRLPEFAADVFGLAQNYLYTGVLLPDEAAAATAAAPSYESLVSLWKLGYELGIDGLCDKALDAMTECRRLTQRIPAAPLLIQVWRDAPEGSSIRVLLLSWAAEYMRRSDARAEFAKSLPQEVLSELVVAMSSVEQSSPAVVTEASSVAHPPPVAAARKSVHYLTDEEEEDTSRSVKTKKTRRTSEAPTATTDRKMATPASATAANRGPPVGKGQKRRSSSAVAAAAAAAASSSAATTTNPDGRAFTTAQKLDFCADLLTRMLSGPGKKKTAQRGRRRRGLDKGGSGFWTRLVGPFKDPVEPMEDGVPDYLEKIKRPMDLGTIKAKVDRREYKDEEEFLADVRQIFENCFTYWKKGDPMWAAGEKLQKTFEEKYSHMNRWISKMGGEEGE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.13
3	0.14
4	0.15
5	0.17
6	0.2
7	0.21
8	0.24
9	0.29
10	0.31
11	0.4
12	0.43
13	0.42
14	0.39
15	0.41
16	0.44
17	0.41
18	0.43
19	0.36
20	0.42
21	0.4
22	0.42
23	0.4
24	0.35
25	0.33
26	0.25
27	0.24
28	0.13
29	0.14
30	0.13
31	0.12
32	0.11
33	0.11
34	0.12
35	0.08
36	0.09
37	0.1
38	0.12
39	0.12
40	0.14
41	0.14
42	0.21
43	0.26
44	0.27
45	0.29
46	0.27
47	0.3
48	0.33
49	0.4
50	0.39
51	0.4
52	0.45
53	0.42
54	0.46
55	0.45
56	0.41
57	0.37
58	0.3
59	0.26
60	0.19
61	0.19
62	0.15
63	0.14
64	0.14
65	0.13
66	0.12
67	0.12
68	0.13
69	0.12
70	0.12
71	0.11
72	0.09
73	0.09
74	0.09
75	0.1
76	0.07
77	0.07
78	0.07
79	0.08
80	0.08
81	0.07
82	0.07
83	0.06
84	0.06
85	0.07
86	0.06
87	0.06
88	0.06
89	0.06
90	0.06
91	0.06
92	0.06
93	0.05
94	0.05
95	0.05
96	0.05
97	0.04
98	0.04
99	0.04
100	0.04
101	0.04
102	0.04
103	0.04
104	0.04
105	0.06
106	0.06
107	0.06
108	0.06
109	0.09
110	0.09
111	0.1
112	0.1
113	0.08
114	0.08
115	0.08
116	0.08
117	0.06
118	0.06
119	0.06
120	0.06
121	0.06
122	0.06
123	0.06
124	0.06
125	0.05
126	0.05
127	0.05
128	0.05
129	0.06
130	0.07
131	0.13
132	0.16
133	0.21
134	0.21
135	0.23
136	0.25
137	0.27
138	0.28
139	0.31
140	0.35
141	0.34
142	0.39
143	0.36
144	0.35
145	0.33
146	0.31
147	0.24
148	0.18
149	0.14
150	0.11
151	0.11
152	0.12
153	0.12
154	0.11
155	0.1
156	0.14
157	0.15
158	0.15
159	0.15
160	0.13
161	0.12
162	0.12
163	0.12
164	0.07
165	0.07
166	0.06
167	0.05
168	0.05
169	0.05
170	0.07
171	0.07
172	0.09
173	0.13
174	0.13
175	0.14
176	0.19
177	0.21
178	0.25
179	0.27
180	0.27
181	0.25
182	0.25
183	0.28
184	0.23
185	0.22
186	0.17
187	0.15
188	0.13
189	0.11
190	0.12
191	0.08
192	0.08
193	0.06
194	0.06
195	0.05
196	0.04
197	0.04
198	0.03
199	0.03
200	0.03
201	0.03
202	0.03
203	0.03
204	0.04
205	0.04
206	0.04
207	0.04
208	0.04
209	0.04
210	0.05
211	0.05
212	0.05
213	0.05
214	0.06
215	0.06
216	0.07
217	0.06
218	0.05
219	0.06
220	0.1
221	0.11
222	0.11
223	0.15
224	0.15
225	0.16
226	0.18
227	0.17
228	0.15
229	0.15
230	0.15
231	0.14
232	0.16
233	0.15
234	0.14
235	0.14
236	0.13
237	0.12
238	0.11
239	0.1
240	0.07
241	0.09
242	0.11
243	0.16
244	0.25
245	0.34
246	0.43
247	0.53
248	0.6
249	0.65
250	0.7
251	0.72
252	0.73
253	0.7
254	0.62
255	0.55
256	0.52
257	0.47
258	0.4
259	0.34
260	0.24
261	0.18
262	0.18
263	0.16
264	0.12
265	0.12
266	0.12
267	0.13
268	0.15
269	0.15
270	0.16
271	0.17
272	0.17
273	0.16
274	0.16
275	0.14
276	0.12
277	0.19
278	0.25
279	0.29
280	0.38
281	0.48
282	0.55
283	0.59
284	0.62
285	0.58
286	0.55
287	0.5
288	0.47
289	0.4
290	0.32
291	0.28
292	0.24
293	0.2
294	0.14
295	0.12
296	0.05
297	0.02
298	0.02
299	0.02
300	0.02
301	0.02
302	0.03
303	0.03
304	0.06
305	0.09
306	0.13
307	0.14
308	0.15
309	0.16
310	0.17
311	0.2
312	0.19
313	0.2
314	0.23
315	0.23
316	0.24
317	0.24
318	0.24
319	0.21
320	0.2
321	0.17
322	0.12
323	0.1
324	0.1
325	0.1
326	0.09
327	0.08
328	0.08
329	0.09
330	0.11
331	0.16
332	0.22
333	0.27
334	0.3
335	0.35
336	0.41
337	0.51
338	0.59
339	0.65
340	0.69
341	0.75
342	0.81
343	0.86
344	0.86
345	0.83
346	0.82
347	0.82
348	0.78
349	0.74
350	0.68
351	0.61
352	0.56
353	0.5
354	0.4
355	0.31
356	0.25
357	0.17
358	0.19
359	0.21
360	0.2
361	0.21
362	0.26
363	0.27
364	0.28
365	0.28
366	0.24
367	0.25
368	0.24
369	0.23
370	0.2
371	0.19
372	0.16
373	0.16
374	0.15
375	0.1
376	0.11
377	0.16
378	0.16
379	0.17
380	0.21
381	0.25
382	0.26
383	0.28
384	0.29
385	0.32
386	0.34
387	0.37
388	0.39
389	0.38
390	0.37
391	0.41
392	0.44
393	0.41
394	0.46
395	0.52
396	0.52
397	0.59
398	0.63
399	0.66
400	0.67
401	0.64
402	0.56
403	0.49
404	0.42
405	0.33
406	0.3
407	0.23
408	0.17
409	0.17
410	0.17
411	0.15
412	0.16
413	0.19
414	0.2
415	0.2
416	0.25
417	0.26
418	0.29
419	0.31
420	0.34
421	0.35
422	0.34
423	0.42
424	0.4
425	0.42
426	0.43
427	0.43
428	0.4
429	0.39
430	0.45
431	0.38
432	0.36
433	0.34
434	0.29
435	0.32
436	0.35
437	0.38
438	0.37
439	0.37
440	0.45
441	0.51
442	0.55
443	0.57
444	0.58
445	0.54
446	0.54
447	0.58
448	0.49
449	0.43
450	0.41

A0A369H0P9

3D AlphaFold-predicted Structure Viewer