Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GFC5

Protein Details
Accession A0A369GFC5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-80IHFATLKPEQKKKKQEKKDKKKAKKGKDNGSAAABasic
NLS Segment(s)
PositionSequence
55-83EQKKKKQEKKDKKKAKKGKDNGSAAAGRK
Subcellular Location(s) cyto 11, cyto_nucl 8.5, extr 5, nucl 4, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MANFDFLKSIGATNEAVAVLNDQPNVFATIIAVLIGLGLELLLLWYIHFATLKPEQKKKKQEKKDKKKAKKGKDNGSAAAGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.09
5 0.1
6 0.09
7 0.1
8 0.1
9 0.09
10 0.09
11 0.1
12 0.12
13 0.11
14 0.09
15 0.07
16 0.07
17 0.07
18 0.07
19 0.06
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.01
27 0.01
28 0.01
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.04
37 0.08
38 0.16
39 0.24
40 0.3
41 0.38
42 0.47
43 0.57
44 0.68
45 0.75
46 0.78
47 0.82
48 0.87
49 0.91
50 0.93
51 0.95
52 0.96
53 0.96
54 0.96
55 0.96
56 0.95
57 0.95
58 0.94
59 0.93
60 0.92
61 0.87
62 0.78
63 0.74