Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GLV0

Protein Details
Accession A0A369GLV0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
26-55QASVKSQGAYKKKNKRTTPKKLGAKKTGDQHydrophilic
192-221IRMGRFRTRKQSYRFRRWMRERQRVGLRKAHydrophilic
NLS Segment(s)
PositionSequence
36-51KKKNKRTTPKKLGAKK
195-261GRFRTRKQSYRFRRWMRERQRVGLRKAKLKMSLEGGAAGRSAAQTVSKKAAKRAAKLARHDKTAKRR
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MSLLCLVRRPLVRISSGPWAVQGLRQASVKSQGAYKKKNKRTTPKKLGAKKTGDQFVIPGNILFKQRGSVWWPGENCFMGRDHTIHTKVSGYVKFYRDPERHPDRKYIGVVFNKEDKLPYGRHAERKRRLGMVAHPRAVPAGPPEKLSPSGIPYEVLRVQPGEQDRLLRLRDNYSYREDNWRIGKLVKTTAIRMGRFRTRKQSYRFRRWMRERQRVGLRKAKLKMSLEGGAAGRSAAQTVSKKAAKRAAKLARHDKTAKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.4
4 0.36
5 0.31
6 0.29
7 0.26
8 0.26
9 0.28
10 0.21
11 0.22
12 0.23
13 0.23
14 0.23
15 0.29
16 0.29
17 0.25
18 0.28
19 0.34
20 0.41
21 0.51
22 0.59
23 0.62
24 0.7
25 0.79
26 0.84
27 0.87
28 0.89
29 0.91
30 0.92
31 0.91
32 0.92
33 0.91
34 0.91
35 0.89
36 0.85
37 0.79
38 0.76
39 0.72
40 0.62
41 0.52
42 0.44
43 0.38
44 0.32
45 0.27
46 0.19
47 0.14
48 0.16
49 0.17
50 0.17
51 0.13
52 0.13
53 0.14
54 0.16
55 0.19
56 0.23
57 0.25
58 0.3
59 0.31
60 0.31
61 0.33
62 0.31
63 0.27
64 0.21
65 0.19
66 0.15
67 0.16
68 0.15
69 0.15
70 0.21
71 0.22
72 0.21
73 0.22
74 0.21
75 0.22
76 0.26
77 0.24
78 0.22
79 0.26
80 0.28
81 0.3
82 0.32
83 0.38
84 0.35
85 0.38
86 0.43
87 0.47
88 0.52
89 0.51
90 0.55
91 0.49
92 0.51
93 0.49
94 0.44
95 0.4
96 0.38
97 0.38
98 0.33
99 0.34
100 0.31
101 0.29
102 0.25
103 0.2
104 0.19
105 0.18
106 0.18
107 0.23
108 0.26
109 0.35
110 0.43
111 0.52
112 0.56
113 0.62
114 0.62
115 0.55
116 0.53
117 0.46
118 0.45
119 0.46
120 0.44
121 0.39
122 0.36
123 0.34
124 0.33
125 0.3
126 0.22
127 0.15
128 0.15
129 0.13
130 0.15
131 0.16
132 0.17
133 0.19
134 0.2
135 0.16
136 0.14
137 0.15
138 0.14
139 0.14
140 0.12
141 0.14
142 0.15
143 0.15
144 0.13
145 0.12
146 0.12
147 0.15
148 0.17
149 0.16
150 0.15
151 0.16
152 0.17
153 0.2
154 0.21
155 0.2
156 0.2
157 0.21
158 0.26
159 0.28
160 0.3
161 0.32
162 0.34
163 0.33
164 0.41
165 0.39
166 0.39
167 0.39
168 0.38
169 0.34
170 0.33
171 0.35
172 0.28
173 0.3
174 0.3
175 0.28
176 0.27
177 0.33
178 0.36
179 0.35
180 0.35
181 0.38
182 0.42
183 0.47
184 0.5
185 0.54
186 0.57
187 0.64
188 0.69
189 0.74
190 0.75
191 0.8
192 0.85
193 0.84
194 0.86
195 0.87
196 0.9
197 0.9
198 0.9
199 0.85
200 0.83
201 0.85
202 0.82
203 0.8
204 0.77
205 0.73
206 0.7
207 0.69
208 0.66
209 0.63
210 0.58
211 0.54
212 0.51
213 0.48
214 0.4
215 0.38
216 0.33
217 0.25
218 0.22
219 0.18
220 0.13
221 0.09
222 0.09
223 0.07
224 0.12
225 0.14
226 0.18
227 0.26
228 0.31
229 0.33
230 0.39
231 0.48
232 0.5
233 0.53
234 0.6
235 0.62
236 0.65
237 0.73
238 0.77
239 0.74
240 0.75
241 0.77