Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A369GKJ9

Protein Details
Accession A0A369GKJ9   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-119DLRPKQTRAIRRRLSPKDKARVLEKTKKRNMNFPQRKFHydrophilic
NLS Segment(s)
PositionSequence
84-117RPKQTRAIRRRLSPKDKARVLEKTKKRNMNFPQR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences SSGKVKAAQLWDKSKDDLNKQLEDLKTELGHLRVQKVASSGTKLNKIHDLRKSIARVLTVIKANQRSQLRLFYKNKKYAPLDLRPKQTRAIRRRLSPKDKARVLEKTKKRNMNFPQRKFAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.49
4 0.51
5 0.49
6 0.45
7 0.44
8 0.49
9 0.43
10 0.39
11 0.34
12 0.28
13 0.22
14 0.22
15 0.22
16 0.17
17 0.2
18 0.19
19 0.2
20 0.2
21 0.2
22 0.19
23 0.19
24 0.2
25 0.18
26 0.2
27 0.22
28 0.23
29 0.3
30 0.29
31 0.3
32 0.35
33 0.37
34 0.4
35 0.41
36 0.42
37 0.38
38 0.43
39 0.43
40 0.37
41 0.35
42 0.29
43 0.24
44 0.21
45 0.22
46 0.18
47 0.17
48 0.19
49 0.21
50 0.21
51 0.26
52 0.25
53 0.24
54 0.25
55 0.32
56 0.33
57 0.38
58 0.45
59 0.48
60 0.56
61 0.61
62 0.61
63 0.59
64 0.58
65 0.58
66 0.58
67 0.58
68 0.6
69 0.58
70 0.66
71 0.63
72 0.62
73 0.6
74 0.6
75 0.61
76 0.59
77 0.63
78 0.61
79 0.66
80 0.74
81 0.78
82 0.8
83 0.8
84 0.81
85 0.81
86 0.79
87 0.75
88 0.71
89 0.71
90 0.71
91 0.71
92 0.71
93 0.72
94 0.76
95 0.81
96 0.78
97 0.78
98 0.79
99 0.8
100 0.82
101 0.78
102 0.79
103 0.74
104 0.75