Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KCW4

Protein Details
Accession A0A367KCW4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-34AEPTSKTPLVPKKKPPVSRPKQHRRRSSFEAPTHydrophilic
NLS Segment(s)
PositionSequence
12-27PKKKPPVSRPKQHRRR
Subcellular Location(s) nucl 11, mito 8, cyto 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAEPTSKTPLVPKKKPPVSRPKQHRRRSSFEAPTYNSAGQAPSYVKEPMNATEIDSPGLSLLQLLTLTVCMAGVQFTCMILLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.82
4 0.83
5 0.84
6 0.86
7 0.87
8 0.88
9 0.89
10 0.9
11 0.91
12 0.87
13 0.85
14 0.83
15 0.82
16 0.79
17 0.75
18 0.71
19 0.63
20 0.58
21 0.53
22 0.44
23 0.35
24 0.26
25 0.2
26 0.14
27 0.13
28 0.1
29 0.08
30 0.09
31 0.1
32 0.1
33 0.12
34 0.13
35 0.13
36 0.15
37 0.14
38 0.14
39 0.16
40 0.16
41 0.15
42 0.14
43 0.12
44 0.1
45 0.1
46 0.07
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07