Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KA32

Protein Details
Accession A0A367KA32    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-65TEEVQKKRSRRTVKHERAVVHydrophilic
NLS Segment(s)
PositionSequence
50-61QKKRSRRTVKHE
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MLLLTLYYRTFKFINGKAESYFLQRLNPRKIRWTVIYRRLNKKGITEEVQKKRSRRTVKHERAVVGASWDAIRAKRSQKPDARAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.38
5 0.41
6 0.37
7 0.34
8 0.33
9 0.25
10 0.26
11 0.29
12 0.36
13 0.44
14 0.49
15 0.46
16 0.49
17 0.52
18 0.52
19 0.53
20 0.54
21 0.53
22 0.57
23 0.64
24 0.65
25 0.69
26 0.7
27 0.68
28 0.6
29 0.55
30 0.49
31 0.44
32 0.41
33 0.41
34 0.45
35 0.5
36 0.55
37 0.56
38 0.54
39 0.58
40 0.63
41 0.64
42 0.62
43 0.64
44 0.69
45 0.75
46 0.81
47 0.78
48 0.7
49 0.63
50 0.56
51 0.46
52 0.37
53 0.27
54 0.19
55 0.14
56 0.14
57 0.13
58 0.12
59 0.14
60 0.17
61 0.24
62 0.31
63 0.38
64 0.47
65 0.54
66 0.6