Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IXV9

Protein Details
Accession A0A367IXV9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPTKLQPRARPRKTPKMAESRLRRLEHydrophilic
NLS Segment(s)
PositionSequence
9-16ARPRKTPK
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015898  G-protein_gamma-like_dom  
IPR036284  GGL_sf  
IPR041848  Ste18_fungal  
Gene Ontology GO:0031681  F:G-protein beta-subunit binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
Pfam View protein in Pfam  
PF00631  G-gamma  
PROSITE View protein in PROSITE  
PS50058  G_PROTEIN_GAMMA  
Amino Acid Sequences MPTKLQPRARPRKTPKMAESRLRRLEEYNNYLRNQLNISRITVSEASASLIDYCNNNKDPFLPSIWGPVPKNEDPFTPPESGQCCTIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.85
4 0.84
5 0.83
6 0.82
7 0.81
8 0.8
9 0.73
10 0.65
11 0.57
12 0.57
13 0.55
14 0.53
15 0.5
16 0.46
17 0.44
18 0.45
19 0.42
20 0.35
21 0.3
22 0.26
23 0.23
24 0.2
25 0.2
26 0.19
27 0.19
28 0.2
29 0.18
30 0.15
31 0.11
32 0.1
33 0.09
34 0.08
35 0.08
36 0.06
37 0.06
38 0.06
39 0.07
40 0.09
41 0.12
42 0.14
43 0.14
44 0.14
45 0.16
46 0.18
47 0.19
48 0.2
49 0.18
50 0.16
51 0.22
52 0.24
53 0.28
54 0.25
55 0.28
56 0.33
57 0.34
58 0.39
59 0.34
60 0.34
61 0.32
62 0.36
63 0.35
64 0.31
65 0.29
66 0.3
67 0.32
68 0.32