Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JC95

Protein Details
Accession A0A367JC95    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
101-123EPEPKRKKAKVDTKKNIERNKKEBasic
131-150IKMAKKRKDRDQQTESKRRGBasic
NLS Segment(s)
PositionSequence
104-161PKRKKAKVDTKKNIERNKKENVGEKENIKMAKKRKDRDQQTESKRRGHAIDEKKMRIP
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041232  NPL  
Gene Ontology GO:0016853  F:isomerase activity  
Pfam View protein in Pfam  
PF17800  NPL  
Amino Acid Sequences MKIQGIYGVKVRPRSRITIESGGSFQLTMASLSSFKSLERTSLYVETKKQKILLCSLIPCTRDQQLLNFTRLEGETVTFIVKGKNTVQLSGNYISLEDELEPEPKRKKAKVDTKKNIERNKKENVGEKENIKMAKKRKDRDQQTESKRRGHAIDEKKMRIPESKRHNQAVQDEAKQVKSKVDEKVLQDERIVDDIVSILKARGEPSEEDDDEAITDVNSDTDDEYAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.53
4 0.56
5 0.56
6 0.55
7 0.49
8 0.46
9 0.4
10 0.33
11 0.26
12 0.19
13 0.12
14 0.11
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.11
21 0.1
22 0.1
23 0.14
24 0.14
25 0.16
26 0.19
27 0.2
28 0.22
29 0.28
30 0.32
31 0.32
32 0.38
33 0.43
34 0.43
35 0.43
36 0.44
37 0.4
38 0.4
39 0.41
40 0.41
41 0.36
42 0.35
43 0.38
44 0.37
45 0.35
46 0.33
47 0.3
48 0.27
49 0.26
50 0.25
51 0.24
52 0.29
53 0.31
54 0.32
55 0.3
56 0.27
57 0.25
58 0.25
59 0.21
60 0.13
61 0.1
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.1
70 0.11
71 0.17
72 0.17
73 0.19
74 0.21
75 0.21
76 0.24
77 0.23
78 0.22
79 0.15
80 0.14
81 0.13
82 0.11
83 0.1
84 0.06
85 0.06
86 0.07
87 0.1
88 0.1
89 0.14
90 0.17
91 0.21
92 0.26
93 0.27
94 0.34
95 0.41
96 0.52
97 0.59
98 0.67
99 0.72
100 0.77
101 0.83
102 0.83
103 0.82
104 0.81
105 0.78
106 0.71
107 0.69
108 0.66
109 0.6
110 0.61
111 0.58
112 0.54
113 0.5
114 0.46
115 0.41
116 0.38
117 0.37
118 0.31
119 0.31
120 0.32
121 0.39
122 0.46
123 0.5
124 0.57
125 0.65
126 0.72
127 0.76
128 0.78
129 0.77
130 0.8
131 0.84
132 0.77
133 0.73
134 0.66
135 0.58
136 0.51
137 0.46
138 0.46
139 0.45
140 0.51
141 0.51
142 0.52
143 0.54
144 0.54
145 0.5
146 0.48
147 0.45
148 0.44
149 0.47
150 0.55
151 0.57
152 0.61
153 0.62
154 0.59
155 0.58
156 0.57
157 0.52
158 0.45
159 0.43
160 0.39
161 0.39
162 0.37
163 0.33
164 0.29
165 0.3
166 0.31
167 0.32
168 0.38
169 0.4
170 0.41
171 0.51
172 0.51
173 0.46
174 0.42
175 0.38
176 0.33
177 0.3
178 0.27
179 0.16
180 0.12
181 0.12
182 0.12
183 0.11
184 0.09
185 0.07
186 0.08
187 0.09
188 0.1
189 0.12
190 0.15
191 0.16
192 0.21
193 0.29
194 0.28
195 0.29
196 0.28
197 0.26
198 0.23
199 0.22
200 0.16
201 0.08
202 0.08
203 0.06
204 0.07
205 0.07
206 0.07
207 0.07