Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J788

Protein Details
Accession A0A367J788    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-34EAPTKVSKRASPDDKKKRGKKDPNAPKRALSBasic
NLS Segment(s)
PositionSequence
9-31VSKRASPDDKKKRGKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEAPTKVSKRASPDDKKKRGKKDPNAPKRALSAYMFFSQANREKVIKENPGAKFGEIGKILGARWKELSDEEKKPFVEQAEADKKRYEEEKAKAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.77
4 0.8
5 0.87
6 0.89
7 0.9
8 0.9
9 0.91
10 0.9
11 0.9
12 0.91
13 0.91
14 0.91
15 0.82
16 0.73
17 0.66
18 0.58
19 0.5
20 0.4
21 0.31
22 0.26
23 0.25
24 0.24
25 0.2
26 0.18
27 0.19
28 0.23
29 0.22
30 0.21
31 0.2
32 0.2
33 0.25
34 0.3
35 0.28
36 0.25
37 0.3
38 0.29
39 0.32
40 0.31
41 0.27
42 0.24
43 0.21
44 0.23
45 0.16
46 0.15
47 0.12
48 0.12
49 0.12
50 0.14
51 0.14
52 0.11
53 0.12
54 0.12
55 0.13
56 0.15
57 0.21
58 0.24
59 0.3
60 0.32
61 0.35
62 0.35
63 0.36
64 0.36
65 0.31
66 0.28
67 0.23
68 0.3
69 0.37
70 0.39
71 0.4
72 0.4
73 0.39
74 0.4
75 0.42
76 0.4
77 0.38