Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J6D9

Protein Details
Accession A0A367J6D9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MVESTKKHKKSKSKKGHKKNKKEGKKHSKTKNESTTVBasic
NLS Segment(s)
PositionSequence
6-30KKHKKSKSKKGHKKNKKEGKKHSKT
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 11.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVESTKKHKKSKSKKGHKKNKKEGKKHSKTKNESTTVSFTQDMSSKSVEDTVHAQAIPRTTLTVKVTKTAEAPLPIQTADQHILIQPPKEFVPGNDLGNVVDPLLTFIGYAFLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.94
3 0.96
4 0.96
5 0.96
6 0.96
7 0.96
8 0.95
9 0.95
10 0.95
11 0.95
12 0.95
13 0.93
14 0.92
15 0.92
16 0.89
17 0.88
18 0.86
19 0.8
20 0.72
21 0.66
22 0.61
23 0.52
24 0.47
25 0.37
26 0.27
27 0.24
28 0.24
29 0.21
30 0.17
31 0.16
32 0.13
33 0.13
34 0.15
35 0.14
36 0.12
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.11
43 0.12
44 0.11
45 0.08
46 0.08
47 0.07
48 0.11
49 0.13
50 0.17
51 0.16
52 0.2
53 0.21
54 0.2
55 0.21
56 0.2
57 0.19
58 0.17
59 0.17
60 0.16
61 0.16
62 0.15
63 0.14
64 0.13
65 0.14
66 0.13
67 0.13
68 0.11
69 0.11
70 0.15
71 0.17
72 0.18
73 0.16
74 0.16
75 0.16
76 0.19
77 0.18
78 0.15
79 0.21
80 0.21
81 0.22
82 0.21
83 0.21
84 0.19
85 0.2
86 0.2
87 0.12
88 0.1
89 0.08
90 0.09
91 0.09
92 0.09
93 0.06
94 0.06