Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J6B7

Protein Details
Accession A0A367J6B7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-34PLIPNKKPPVSRPKQHRRRSSFEAPTHydrophilic
NLS Segment(s)
PositionSequence
14-27KKPPVSRPKQHRRR
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, cyto 5.5, mito 5, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTEPTSKTPLIPNKKPPVSRPKQHRRRSSFEAPTYNSAGQAPSYVKEPMNATEIDSPGLSLLQLLTLTVCMAGVQFTCMVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.73
4 0.74
5 0.74
6 0.75
7 0.77
8 0.78
9 0.81
10 0.87
11 0.89
12 0.85
13 0.84
14 0.83
15 0.82
16 0.79
17 0.75
18 0.71
19 0.63
20 0.58
21 0.53
22 0.44
23 0.35
24 0.26
25 0.2
26 0.14
27 0.13
28 0.1
29 0.08
30 0.09
31 0.1
32 0.1
33 0.12
34 0.13
35 0.13
36 0.15
37 0.14
38 0.14
39 0.16
40 0.16
41 0.15
42 0.14
43 0.12
44 0.1
45 0.1
46 0.07
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07