Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367ISP9

Protein Details
Accession A0A367ISP9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MVESTKKHKKNKSKKGHKKNKKEGKKHSKTKSEGTMBasic
NLS Segment(s)
PositionSequence
6-31KKHKKNKSKKGHKKNKKEGKKHSKTK
Subcellular Location(s) nucl 20, cyto_nucl 12.833, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVESTKKHKKNKSKKGHKKNKKEGKKHSKTKSEGTMVSFTQDMSSKNVEDTVHAQAIPKTTLTVKVTKTMETAGPIQTADQHILIQTPKEFVPGHDLGNVVDPLLTFIGYAFLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.97
4 0.96
5 0.96
6 0.96
7 0.96
8 0.96
9 0.95
10 0.95
11 0.95
12 0.95
13 0.93
14 0.92
15 0.91
16 0.85
17 0.81
18 0.78
19 0.71
20 0.63
21 0.56
22 0.5
23 0.4
24 0.36
25 0.28
26 0.2
27 0.16
28 0.15
29 0.13
30 0.13
31 0.14
32 0.13
33 0.13
34 0.15
35 0.14
36 0.13
37 0.15
38 0.15
39 0.14
40 0.13
41 0.14
42 0.13
43 0.14
44 0.13
45 0.1
46 0.08
47 0.08
48 0.13
49 0.14
50 0.18
51 0.17
52 0.23
53 0.24
54 0.24
55 0.24
56 0.21
57 0.2
58 0.18
59 0.19
60 0.13
61 0.13
62 0.12
63 0.12
64 0.12
65 0.13
66 0.12
67 0.1
68 0.09
69 0.09
70 0.11
71 0.12
72 0.11
73 0.11
74 0.12
75 0.11
76 0.14
77 0.15
78 0.14
79 0.21
80 0.21
81 0.21
82 0.21
83 0.21
84 0.18
85 0.22
86 0.21
87 0.13
88 0.12
89 0.1
90 0.11
91 0.11
92 0.1
93 0.06
94 0.06