Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J6E5

Protein Details
Accession A0A367J6E5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-67PPPPPPPAKDTKKRAKDNLRQEEGSHydrophilic
NLS Segment(s)
PositionSequence
40-58RKPPPPPPPPAKDTKKRAK
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPVGQRKSEHAVVKLHQTRAASHTIIGAISTKDAIHIALRKPPPPPPPPAKDTKKRAKDNLRQEEGSYGNRGRGRHYYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.41
4 0.38
5 0.36
6 0.34
7 0.36
8 0.26
9 0.2
10 0.19
11 0.17
12 0.15
13 0.13
14 0.11
15 0.07
16 0.07
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.1
24 0.11
25 0.18
26 0.2
27 0.21
28 0.22
29 0.28
30 0.33
31 0.34
32 0.4
33 0.41
34 0.46
35 0.49
36 0.57
37 0.6
38 0.62
39 0.68
40 0.71
41 0.74
42 0.76
43 0.81
44 0.82
45 0.83
46 0.84
47 0.85
48 0.81
49 0.73
50 0.66
51 0.61
52 0.53
53 0.47
54 0.41
55 0.31
56 0.31
57 0.33
58 0.33
59 0.33