Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367JYG2

Protein Details
Accession A0A367JYG2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
170-196KVKNLHSNMKQRQKKNPNYKNQHKVATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, mito_nucl 13.333, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSLITSRLHVTKVTLAQHLLNPIRQMSHLEKPYLSLNNSKRTMAIVTSLYGNLINNTNDAVNPLIDQVDVTRCCMCHQILGSHGSSMILSCPSSSNKRMCVGCRHFYGKHWKNPKIVAIMNSWIVAGNDDVFCTVVSKSGKRKFDYNSYLSHIITAHNNDFINSNELHRKVKNLHSNMKQRQKKNPNYKNQHKVATISELEEIIKSSNGRCAVSGAIGAWVHGITYKELLLTLDHYVPISKGGSFDISNLQPILGCLNRVKSNRSNAELCLWLERFKNSVKIDKIRFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.32
4 0.34
5 0.39
6 0.35
7 0.32
8 0.3
9 0.29
10 0.28
11 0.26
12 0.3
13 0.28
14 0.34
15 0.36
16 0.36
17 0.35
18 0.36
19 0.41
20 0.4
21 0.36
22 0.37
23 0.39
24 0.45
25 0.48
26 0.46
27 0.4
28 0.37
29 0.37
30 0.28
31 0.26
32 0.18
33 0.16
34 0.17
35 0.17
36 0.15
37 0.14
38 0.13
39 0.11
40 0.13
41 0.12
42 0.11
43 0.12
44 0.12
45 0.11
46 0.12
47 0.11
48 0.09
49 0.09
50 0.09
51 0.08
52 0.07
53 0.08
54 0.08
55 0.13
56 0.13
57 0.15
58 0.16
59 0.16
60 0.17
61 0.21
62 0.2
63 0.17
64 0.18
65 0.19
66 0.2
67 0.23
68 0.23
69 0.19
70 0.19
71 0.15
72 0.13
73 0.11
74 0.09
75 0.06
76 0.06
77 0.06
78 0.09
79 0.12
80 0.17
81 0.22
82 0.25
83 0.27
84 0.32
85 0.34
86 0.36
87 0.43
88 0.45
89 0.44
90 0.45
91 0.48
92 0.43
93 0.46
94 0.54
95 0.51
96 0.53
97 0.57
98 0.58
99 0.57
100 0.59
101 0.58
102 0.51
103 0.45
104 0.39
105 0.32
106 0.28
107 0.25
108 0.22
109 0.18
110 0.13
111 0.1
112 0.08
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.09
123 0.1
124 0.13
125 0.22
126 0.28
127 0.33
128 0.34
129 0.38
130 0.38
131 0.45
132 0.49
133 0.43
134 0.39
135 0.38
136 0.38
137 0.33
138 0.31
139 0.22
140 0.17
141 0.16
142 0.16
143 0.12
144 0.13
145 0.13
146 0.13
147 0.13
148 0.13
149 0.14
150 0.12
151 0.14
152 0.16
153 0.18
154 0.21
155 0.2
156 0.23
157 0.25
158 0.33
159 0.4
160 0.41
161 0.48
162 0.54
163 0.64
164 0.69
165 0.75
166 0.75
167 0.72
168 0.76
169 0.78
170 0.8
171 0.81
172 0.82
173 0.82
174 0.85
175 0.9
176 0.89
177 0.83
178 0.78
179 0.68
180 0.61
181 0.52
182 0.47
183 0.37
184 0.29
185 0.24
186 0.19
187 0.18
188 0.15
189 0.13
190 0.08
191 0.09
192 0.09
193 0.09
194 0.13
195 0.15
196 0.15
197 0.15
198 0.15
199 0.15
200 0.14
201 0.14
202 0.1
203 0.1
204 0.1
205 0.09
206 0.08
207 0.07
208 0.07
209 0.08
210 0.09
211 0.07
212 0.09
213 0.09
214 0.08
215 0.09
216 0.1
217 0.09
218 0.1
219 0.11
220 0.11
221 0.11
222 0.12
223 0.12
224 0.12
225 0.13
226 0.12
227 0.1
228 0.1
229 0.11
230 0.13
231 0.13
232 0.14
233 0.18
234 0.18
235 0.19
236 0.19
237 0.17
238 0.14
239 0.14
240 0.18
241 0.13
242 0.15
243 0.16
244 0.21
245 0.29
246 0.31
247 0.38
248 0.4
249 0.5
250 0.54
251 0.58
252 0.54
253 0.49
254 0.51
255 0.48
256 0.42
257 0.39
258 0.33
259 0.31
260 0.31
261 0.31
262 0.29
263 0.29
264 0.37
265 0.34
266 0.42
267 0.47
268 0.54