Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JQJ1

Protein Details
Accession A0A367JQJ1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-36FDTTKWKKKLTIPLKRHRNNGHWNGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 11.666
Family & Domain DBs
Amino Acid Sequences MLLNSNSTSYFDTTKWKKKLTIPLKRHRNNGHWNGSATAKAAATEKFIRRNKQEVLSEDLTASQFANITGIKKTKRYEEEAHLSDDDADSTTTSASQPLSIWDSHFWHNDRQIETSITSSASQPCISSLTSLPLTRHKSEPGVIQKGRFKITWGMDDEAAMITPEINCVEWKRKKNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.52
4 0.56
5 0.61
6 0.71
7 0.72
8 0.74
9 0.74
10 0.78
11 0.85
12 0.85
13 0.87
14 0.84
15 0.82
16 0.82
17 0.81
18 0.78
19 0.71
20 0.66
21 0.58
22 0.52
23 0.43
24 0.33
25 0.25
26 0.16
27 0.14
28 0.14
29 0.12
30 0.15
31 0.2
32 0.23
33 0.31
34 0.37
35 0.43
36 0.46
37 0.52
38 0.52
39 0.53
40 0.55
41 0.48
42 0.5
43 0.45
44 0.41
45 0.34
46 0.31
47 0.23
48 0.19
49 0.15
50 0.08
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.1
57 0.14
58 0.15
59 0.19
60 0.21
61 0.27
62 0.3
63 0.35
64 0.38
65 0.4
66 0.46
67 0.43
68 0.44
69 0.37
70 0.33
71 0.26
72 0.22
73 0.15
74 0.08
75 0.07
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.09
87 0.09
88 0.1
89 0.11
90 0.14
91 0.16
92 0.19
93 0.2
94 0.21
95 0.26
96 0.29
97 0.28
98 0.28
99 0.27
100 0.25
101 0.24
102 0.22
103 0.17
104 0.14
105 0.13
106 0.13
107 0.13
108 0.13
109 0.13
110 0.12
111 0.12
112 0.13
113 0.12
114 0.13
115 0.11
116 0.14
117 0.16
118 0.18
119 0.19
120 0.25
121 0.3
122 0.32
123 0.34
124 0.32
125 0.32
126 0.33
127 0.4
128 0.41
129 0.45
130 0.44
131 0.47
132 0.5
133 0.51
134 0.52
135 0.43
136 0.37
137 0.36
138 0.38
139 0.39
140 0.37
141 0.36
142 0.33
143 0.33
144 0.3
145 0.23
146 0.19
147 0.13
148 0.09
149 0.07
150 0.06
151 0.08
152 0.08
153 0.08
154 0.11
155 0.16
156 0.26
157 0.34