Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KF17

Protein Details
Accession A0A367KF17    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
56-78LWAAPKKKTSHSKKRMRASNKGLHydrophilic
NLS Segment(s)
PositionSequence
60-73PKKKTSHSKKRMRA
Subcellular Location(s) mito 21, mito_nucl 13.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSLRSLVRFSTRASVLENTVKIQTSRFGTLSLMNSFNNTAVNMNTFQIPSWLEAFLWAAPKKKTSHSKKRMRASNKGLQQKENITTCPVCGNHKMMHHLCGHCYSDIKKKAKLEVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.33
4 0.31
5 0.26
6 0.26
7 0.26
8 0.23
9 0.22
10 0.22
11 0.2
12 0.22
13 0.21
14 0.2
15 0.2
16 0.23
17 0.25
18 0.23
19 0.21
20 0.18
21 0.18
22 0.18
23 0.17
24 0.14
25 0.11
26 0.09
27 0.08
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.09
42 0.08
43 0.12
44 0.12
45 0.14
46 0.14
47 0.18
48 0.19
49 0.26
50 0.35
51 0.42
52 0.52
53 0.6
54 0.7
55 0.76
56 0.83
57 0.85
58 0.82
59 0.82
60 0.79
61 0.77
62 0.74
63 0.75
64 0.68
65 0.61
66 0.57
67 0.52
68 0.5
69 0.43
70 0.36
71 0.31
72 0.28
73 0.27
74 0.28
75 0.25
76 0.23
77 0.25
78 0.27
79 0.28
80 0.31
81 0.38
82 0.35
83 0.39
84 0.41
85 0.39
86 0.37
87 0.38
88 0.37
89 0.31
90 0.33
91 0.32
92 0.36
93 0.44
94 0.46
95 0.48
96 0.5