Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367K061

Protein Details
Accession A0A367K061    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-53AENWKNAKENPKNKKDDKETAAHydrophilic
NLS Segment(s)
PositionSequence
35-46WKNAKENPKNKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, cyto 6, cyto_pero 3.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04690  YABBY  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MSPYNNFMKTELAKVKKENPDIAHKDAFKKAAENWKNAKENPKNKKDDKETAAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.52
4 0.55
5 0.53
6 0.47
7 0.52
8 0.53
9 0.54
10 0.5
11 0.43
12 0.43
13 0.39
14 0.37
15 0.28
16 0.24
17 0.23
18 0.3
19 0.32
20 0.35
21 0.39
22 0.45
23 0.49
24 0.5
25 0.56
26 0.56
27 0.62
28 0.67
29 0.71
30 0.72
31 0.74
32 0.82
33 0.8
34 0.8
35 0.76