Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J3J7

Protein Details
Accession A0A367J3J7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
36-64GSETAAKKKKKNKKKKKGPKTQTEPPTVPBasic
NLS Segment(s)
PositionSequence
41-55AKKKKKNKKKKKGPK
Subcellular Location(s) nucl 17, cyto_nucl 13.333, cyto 7.5, cyto_pero 4.666
Family & Domain DBs
Amino Acid Sequences MVTAEEVNQVAEKLEETQIESAEENNDQATEDTGAGSETAAKKKKKNKKKKKGPKTQTEPPTVPVSKIYTNKVYPVGECHDYVNEYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.14
5 0.14
6 0.14
7 0.14
8 0.12
9 0.12
10 0.12
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.07
25 0.09
26 0.14
27 0.2
28 0.23
29 0.29
30 0.39
31 0.5
32 0.58
33 0.67
34 0.73
35 0.79
36 0.88
37 0.93
38 0.95
39 0.96
40 0.95
41 0.95
42 0.92
43 0.9
44 0.87
45 0.83
46 0.73
47 0.65
48 0.62
49 0.52
50 0.43
51 0.37
52 0.32
53 0.31
54 0.34
55 0.36
56 0.34
57 0.35
58 0.37
59 0.39
60 0.36
61 0.3
62 0.31
63 0.32
64 0.29
65 0.28
66 0.28
67 0.25
68 0.26