Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367IS21

Protein Details
Accession A0A367IS21    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-41RSYDEPKKGKSSKKSKPKLSRKRKAAGSEBasic
NLS Segment(s)
PositionSequence
18-48PKKGKSSKKSKPKLSRKRKAAGSEEPSGSRK
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTASLIQAFKSLRSYDEPKKGKSSKKSKPKLSRKRKAAGSEEPSGSRKRACPNASDFASSSAAQHAPAPPSQPSAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.46
4 0.5
5 0.49
6 0.58
7 0.62
8 0.64
9 0.68
10 0.7
11 0.69
12 0.76
13 0.82
14 0.83
15 0.87
16 0.9
17 0.91
18 0.91
19 0.91
20 0.89
21 0.87
22 0.83
23 0.78
24 0.73
25 0.7
26 0.64
27 0.58
28 0.51
29 0.45
30 0.41
31 0.35
32 0.3
33 0.24
34 0.23
35 0.25
36 0.33
37 0.33
38 0.35
39 0.4
40 0.46
41 0.46
42 0.44
43 0.38
44 0.32
45 0.33
46 0.28
47 0.23
48 0.19
49 0.17
50 0.15
51 0.17
52 0.17
53 0.17
54 0.18
55 0.21
56 0.2
57 0.24