Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367K738

Protein Details
Accession A0A367K738    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-106HARIVRVRSRTERRNRLPPPRFRFQKTAHydrophilic
NLS Segment(s)
PositionSequence
90-99ERRNRLPPPR
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences TSKRRNNGRNQHGRGHTKFVRCINCYRCVPKDKAIKRFTIRNMVETAAIRDIQEASVYEEYAIPKLYVKLHYCVSCAIHARIVRVRSRTERRNRLPPPRFRFQKTANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.73
3 0.68
4 0.63
5 0.64
6 0.62
7 0.61
8 0.55
9 0.6
10 0.55
11 0.57
12 0.57
13 0.56
14 0.56
15 0.55
16 0.56
17 0.55
18 0.61
19 0.61
20 0.65
21 0.63
22 0.63
23 0.61
24 0.64
25 0.6
26 0.59
27 0.53
28 0.45
29 0.43
30 0.36
31 0.33
32 0.26
33 0.24
34 0.14
35 0.14
36 0.11
37 0.1
38 0.09
39 0.08
40 0.08
41 0.06
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.09
48 0.09
49 0.1
50 0.07
51 0.07
52 0.09
53 0.11
54 0.15
55 0.17
56 0.19
57 0.22
58 0.23
59 0.23
60 0.24
61 0.23
62 0.21
63 0.22
64 0.21
65 0.22
66 0.22
67 0.24
68 0.27
69 0.3
70 0.31
71 0.32
72 0.37
73 0.42
74 0.51
75 0.57
76 0.63
77 0.7
78 0.73
79 0.81
80 0.84
81 0.86
82 0.86
83 0.87
84 0.84
85 0.84
86 0.84
87 0.8
88 0.8
89 0.78