Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IXW0

Protein Details
Accession A0A367IXW0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSKASRPLKRKISPENKDSRRPRLNHydrophilic
NLS Segment(s)
PositionSequence
6-23RPLKRKISPENKDSRRPR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038077  Troponin_sf  
Amino Acid Sequences MSKASRPLKRKISPENKDSRRPRLNTSAPPRIPVRPTLASSRSSTPESKKTVTTKKVPSWDTRGQMNQLQTKLEETGNEVDEIEKLHHDLQSSVQDQDSILQEAKQKVADLETALNVRKPKHMSILLILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.8
4 0.83
5 0.81
6 0.8
7 0.79
8 0.75
9 0.72
10 0.71
11 0.72
12 0.72
13 0.73
14 0.74
15 0.65
16 0.65
17 0.61
18 0.55
19 0.49
20 0.43
21 0.4
22 0.34
23 0.36
24 0.38
25 0.38
26 0.36
27 0.36
28 0.36
29 0.32
30 0.32
31 0.33
32 0.31
33 0.35
34 0.37
35 0.36
36 0.38
37 0.42
38 0.47
39 0.49
40 0.52
41 0.52
42 0.53
43 0.58
44 0.56
45 0.53
46 0.53
47 0.52
48 0.47
49 0.43
50 0.38
51 0.34
52 0.34
53 0.34
54 0.3
55 0.25
56 0.23
57 0.2
58 0.2
59 0.19
60 0.16
61 0.12
62 0.11
63 0.13
64 0.13
65 0.13
66 0.12
67 0.1
68 0.1
69 0.11
70 0.09
71 0.07
72 0.08
73 0.09
74 0.1
75 0.1
76 0.11
77 0.13
78 0.19
79 0.2
80 0.19
81 0.18
82 0.17
83 0.17
84 0.19
85 0.18
86 0.14
87 0.12
88 0.14
89 0.18
90 0.2
91 0.22
92 0.2
93 0.18
94 0.17
95 0.18
96 0.17
97 0.14
98 0.15
99 0.15
100 0.17
101 0.18
102 0.21
103 0.23
104 0.23
105 0.28
106 0.31
107 0.32
108 0.38
109 0.41
110 0.41