Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367ILC7

Protein Details
Accession A0A367ILC7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-26QLDAKIKELKEKIKRNERMRDKAYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011072  HR1_rho-bd  
IPR036274  HR1_rpt_sf  
Gene Ontology GO:0007165  P:signal transduction  
PROSITE View protein in PROSITE  
PS51860  REM_1  
Amino Acid Sequences DQLDAKIKELKEKIKRNERMRDKAYQLRPLLTDKNALSQCENEIKECQKSIDYFTEELLKIESRKDSDTTETDASSHTTHHTSTSNPSVEHPTVKKYSTLDLLTTETLYNKSKVSLKLHELEYKLDVENKVLAGIKTMADVMDKDPSLSDRRRRLELQGQMYESIEKLNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.81
3 0.82
4 0.87
5 0.87
6 0.87
7 0.82
8 0.8
9 0.77
10 0.77
11 0.74
12 0.72
13 0.64
14 0.57
15 0.54
16 0.5
17 0.47
18 0.39
19 0.38
20 0.29
21 0.36
22 0.35
23 0.34
24 0.3
25 0.27
26 0.29
27 0.3
28 0.3
29 0.24
30 0.27
31 0.28
32 0.29
33 0.29
34 0.27
35 0.22
36 0.22
37 0.24
38 0.25
39 0.25
40 0.23
41 0.23
42 0.26
43 0.24
44 0.23
45 0.2
46 0.16
47 0.14
48 0.15
49 0.16
50 0.14
51 0.15
52 0.17
53 0.17
54 0.19
55 0.21
56 0.23
57 0.22
58 0.2
59 0.18
60 0.18
61 0.17
62 0.14
63 0.12
64 0.1
65 0.1
66 0.1
67 0.11
68 0.12
69 0.11
70 0.15
71 0.19
72 0.18
73 0.18
74 0.19
75 0.22
76 0.22
77 0.24
78 0.22
79 0.21
80 0.22
81 0.23
82 0.23
83 0.19
84 0.21
85 0.21
86 0.21
87 0.17
88 0.17
89 0.18
90 0.16
91 0.16
92 0.14
93 0.1
94 0.12
95 0.13
96 0.13
97 0.12
98 0.14
99 0.18
100 0.23
101 0.28
102 0.3
103 0.33
104 0.37
105 0.4
106 0.42
107 0.38
108 0.35
109 0.31
110 0.28
111 0.24
112 0.23
113 0.2
114 0.16
115 0.16
116 0.15
117 0.14
118 0.14
119 0.13
120 0.12
121 0.13
122 0.12
123 0.11
124 0.11
125 0.1
126 0.09
127 0.1
128 0.1
129 0.14
130 0.13
131 0.13
132 0.14
133 0.17
134 0.23
135 0.3
136 0.37
137 0.42
138 0.47
139 0.53
140 0.55
141 0.6
142 0.62
143 0.64
144 0.63
145 0.6
146 0.57
147 0.52
148 0.5
149 0.43
150 0.34