Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367IL32

Protein Details
Accession A0A367IL32    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-75HWFRLKTDTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
36-69KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences GTIPAWYQRERRALPLEQVESLIQMPSQKSFITKVKLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.48
4 0.39
5 0.38
6 0.32
7 0.26
8 0.23
9 0.17
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.1
16 0.11
17 0.15
18 0.19
19 0.21
20 0.24
21 0.27
22 0.33
23 0.4
24 0.41
25 0.45
26 0.51
27 0.57
28 0.63
29 0.69
30 0.69
31 0.69
32 0.75
33 0.77
34 0.76
35 0.74
36 0.74
37 0.66
38 0.63
39 0.64
40 0.62
41 0.58
42 0.59
43 0.59
44 0.58
45 0.67
46 0.7
47 0.73
48 0.77
49 0.8
50 0.81
51 0.84
52 0.83
53 0.84
54 0.87
55 0.85