Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IWW1

Protein Details
Accession A0A367IWW1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-122VSSLCHPQLVRQRRRNKGHNYPNKKTQKTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 15, cyto 6
Family & Domain DBs
Amino Acid Sequences MDVDLPEAKDVQLREPDDRHRLAHYTDRISFLSRLPLFTNALNMSPRLALELYPSNVLCQILTQSWSKEIPPLPSTVLSHAADYHSQIRTMSVSSLCHPQLVRQRRRNKGHNYPNKKTQKTISRVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.41
4 0.45
5 0.46
6 0.43
7 0.39
8 0.39
9 0.38
10 0.42
11 0.41
12 0.39
13 0.39
14 0.4
15 0.38
16 0.38
17 0.35
18 0.28
19 0.31
20 0.26
21 0.25
22 0.24
23 0.25
24 0.23
25 0.22
26 0.25
27 0.16
28 0.18
29 0.17
30 0.15
31 0.13
32 0.12
33 0.12
34 0.1
35 0.09
36 0.07
37 0.1
38 0.12
39 0.13
40 0.14
41 0.14
42 0.12
43 0.13
44 0.13
45 0.09
46 0.07
47 0.07
48 0.06
49 0.08
50 0.09
51 0.08
52 0.1
53 0.11
54 0.11
55 0.13
56 0.15
57 0.17
58 0.17
59 0.18
60 0.17
61 0.18
62 0.19
63 0.17
64 0.2
65 0.17
66 0.16
67 0.16
68 0.16
69 0.14
70 0.16
71 0.18
72 0.14
73 0.14
74 0.13
75 0.14
76 0.13
77 0.14
78 0.14
79 0.11
80 0.12
81 0.14
82 0.2
83 0.19
84 0.21
85 0.2
86 0.24
87 0.33
88 0.42
89 0.51
90 0.55
91 0.65
92 0.73
93 0.82
94 0.85
95 0.86
96 0.86
97 0.87
98 0.89
99 0.89
100 0.87
101 0.88
102 0.89
103 0.83
104 0.78
105 0.76
106 0.75