Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JMY1

Protein Details
Accession A0A367JMY1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-89EEALNKLREKYKKKRIKKVIRKIRNSVGGIHydrophilic
NLS Segment(s)
PositionSequence
65-83KLREKYKKKRIKKVIRKIR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSNKKRPKNVHPKIANAIITSVEIPFLPPDIRNTFIRPDTIRLYIPKEEERDSEEEKEEEEALNKLREKYKKKRIKKVIRKIRNSVGGIRFTVIWENDEEEVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.65
3 0.54
4 0.45
5 0.34
6 0.29
7 0.22
8 0.16
9 0.1
10 0.08
11 0.08
12 0.07
13 0.08
14 0.08
15 0.08
16 0.13
17 0.16
18 0.19
19 0.2
20 0.23
21 0.25
22 0.26
23 0.29
24 0.25
25 0.26
26 0.26
27 0.26
28 0.25
29 0.23
30 0.26
31 0.25
32 0.26
33 0.25
34 0.25
35 0.24
36 0.23
37 0.25
38 0.24
39 0.25
40 0.23
41 0.21
42 0.19
43 0.18
44 0.18
45 0.15
46 0.11
47 0.1
48 0.09
49 0.1
50 0.13
51 0.14
52 0.16
53 0.22
54 0.3
55 0.38
56 0.48
57 0.57
58 0.65
59 0.73
60 0.82
61 0.86
62 0.9
63 0.92
64 0.93
65 0.93
66 0.93
67 0.92
68 0.88
69 0.85
70 0.83
71 0.74
72 0.71
73 0.65
74 0.58
75 0.5
76 0.44
77 0.35
78 0.28
79 0.3
80 0.22
81 0.18
82 0.17
83 0.19