Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JJU3

Protein Details
Accession A0A367JJU3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-76SAQDKERKKTWNKKKLTSKQKAETHydrophilic
NLS Segment(s)
PositionSequence
59-67RKKTWNKKK
Subcellular Location(s) nucl 11, cyto 11, cyto_nucl 11
Family & Domain DBs
Amino Acid Sequences MDILNGEYGKLAQLRLDHAESIKNEWQVYCKEQRAIRKADAEKRQVEFDEELSAQDKERKKTWNKKKLTSKQKAETCQQLIELLKDQKQLEIVNDTDFHIDTSVIMMPSSTMELFWALDMDPPIMKSEIDSTITLLSQMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.22
4 0.21
5 0.21
6 0.26
7 0.25
8 0.3
9 0.31
10 0.28
11 0.27
12 0.26
13 0.29
14 0.28
15 0.33
16 0.34
17 0.33
18 0.36
19 0.39
20 0.48
21 0.51
22 0.53
23 0.51
24 0.52
25 0.55
26 0.59
27 0.63
28 0.6
29 0.57
30 0.53
31 0.51
32 0.43
33 0.4
34 0.32
35 0.24
36 0.21
37 0.17
38 0.16
39 0.15
40 0.15
41 0.12
42 0.17
43 0.21
44 0.2
45 0.24
46 0.32
47 0.4
48 0.5
49 0.61
50 0.65
51 0.67
52 0.74
53 0.81
54 0.83
55 0.85
56 0.84
57 0.81
58 0.8
59 0.79
60 0.74
61 0.67
62 0.63
63 0.54
64 0.45
65 0.37
66 0.3
67 0.24
68 0.21
69 0.22
70 0.18
71 0.18
72 0.21
73 0.21
74 0.19
75 0.2
76 0.19
77 0.16
78 0.17
79 0.16
80 0.14
81 0.14
82 0.15
83 0.14
84 0.13
85 0.12
86 0.09
87 0.08
88 0.07
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.09
97 0.07
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.08
106 0.09
107 0.1
108 0.1
109 0.1
110 0.13
111 0.13
112 0.12
113 0.12
114 0.14
115 0.17
116 0.19
117 0.19
118 0.18
119 0.18
120 0.19