Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367J4M2

Protein Details
Accession A0A367J4M2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-23LQPARKRQKRSVEATQKEKRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences MDLQPARKRQKRSVEATQKEKRIDFVISSFSKELALKVFSYLSSADLVQCAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.8
5 0.75
6 0.69
7 0.61
8 0.51
9 0.42
10 0.36
11 0.27
12 0.2
13 0.21
14 0.18
15 0.2
16 0.18
17 0.16
18 0.16
19 0.16
20 0.15
21 0.11
22 0.13
23 0.11
24 0.12
25 0.12
26 0.11
27 0.12
28 0.12
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1