Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J4M8

Protein Details
Accession A0A367J4M8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-45PADIERKRQLNKEKTAKKRKLAAENPHydrophilic
NLS Segment(s)
PositionSequence
25-41RKRQLNKEKTAKKRKLA
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
PROSITE View protein in PROSITE  
PS50889  S4  
Amino Acid Sequences MTVADDAVTMNKEKMVEKTPADIERKRQLNKEKTAKKRKLAAENPIYQEIKRRELAEGKKSRSCNRKEDDFRNVDDIHTAVYYFEDDLRKVKPYYFEYKSFAKGRWLNRPLLEVFASEFRDRNEEYYRYAIERGLLTINDKPVTADTLIKTSDVIGHKIHRHEPPCTDEPIKIVHEEDDLLVINKPGGIPVHPAGRFRHNTVIHVLKKEHNIPKLYPANRLDLPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.27
4 0.27
5 0.32
6 0.36
7 0.41
8 0.46
9 0.46
10 0.48
11 0.52
12 0.58
13 0.58
14 0.61
15 0.65
16 0.68
17 0.74
18 0.78
19 0.78
20 0.81
21 0.88
22 0.88
23 0.85
24 0.84
25 0.82
26 0.82
27 0.8
28 0.79
29 0.76
30 0.74
31 0.71
32 0.68
33 0.6
34 0.49
35 0.51
36 0.45
37 0.41
38 0.37
39 0.34
40 0.32
41 0.39
42 0.46
43 0.48
44 0.52
45 0.53
46 0.56
47 0.59
48 0.64
49 0.65
50 0.63
51 0.62
52 0.6
53 0.65
54 0.67
55 0.69
56 0.7
57 0.65
58 0.61
59 0.56
60 0.5
61 0.39
62 0.32
63 0.25
64 0.16
65 0.13
66 0.11
67 0.06
68 0.06
69 0.06
70 0.06
71 0.08
72 0.09
73 0.09
74 0.11
75 0.12
76 0.15
77 0.15
78 0.17
79 0.2
80 0.23
81 0.31
82 0.33
83 0.35
84 0.36
85 0.38
86 0.41
87 0.38
88 0.34
89 0.33
90 0.34
91 0.36
92 0.43
93 0.43
94 0.41
95 0.39
96 0.41
97 0.34
98 0.3
99 0.26
100 0.16
101 0.14
102 0.13
103 0.15
104 0.13
105 0.13
106 0.11
107 0.14
108 0.14
109 0.16
110 0.18
111 0.17
112 0.19
113 0.21
114 0.21
115 0.19
116 0.2
117 0.17
118 0.14
119 0.13
120 0.12
121 0.1
122 0.1
123 0.11
124 0.12
125 0.14
126 0.13
127 0.12
128 0.12
129 0.11
130 0.13
131 0.12
132 0.13
133 0.11
134 0.13
135 0.14
136 0.13
137 0.13
138 0.11
139 0.15
140 0.14
141 0.16
142 0.15
143 0.2
144 0.24
145 0.27
146 0.33
147 0.34
148 0.36
149 0.38
150 0.4
151 0.43
152 0.42
153 0.44
154 0.4
155 0.34
156 0.32
157 0.33
158 0.3
159 0.23
160 0.21
161 0.17
162 0.16
163 0.15
164 0.14
165 0.11
166 0.1
167 0.1
168 0.1
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.08
176 0.13
177 0.15
178 0.23
179 0.25
180 0.28
181 0.3
182 0.38
183 0.41
184 0.41
185 0.47
186 0.41
187 0.42
188 0.47
189 0.52
190 0.48
191 0.49
192 0.48
193 0.44
194 0.49
195 0.56
196 0.57
197 0.54
198 0.54
199 0.51
200 0.58
201 0.62
202 0.57
203 0.57
204 0.51
205 0.52