Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JK41

Protein Details
Accession A0A367JK41    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
149-170EEAAKLKEKKKALKKAKKTSSNHydrophilic
NLS Segment(s)
PositionSequence
152-167AKLKEKKKALKKAKKT
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF16589  BRCT_2  
PROSITE View protein in PROSITE  
PS50172  BRCT  
CDD cd17709  BRCT_pescadillo_like  
Amino Acid Sequences IQAASNEAAELQSLFEGQKFFLSRETPRYALEFMIRSCGGQVSWDPSVGVNPPFAESDETINYQITDRPSVRNRVLSRKYVQPQWVADCINARKILKPSLYEPGAELPAHLSPFVEARAGDYVPKAVMMTNKQRKLYNKMQHGIQQKAEEAAKLKEKKKALKKAKKTSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.09
5 0.14
6 0.15
7 0.15
8 0.19
9 0.23
10 0.25
11 0.32
12 0.37
13 0.34
14 0.34
15 0.36
16 0.33
17 0.3
18 0.3
19 0.26
20 0.21
21 0.24
22 0.23
23 0.2
24 0.19
25 0.18
26 0.14
27 0.12
28 0.13
29 0.13
30 0.14
31 0.14
32 0.14
33 0.13
34 0.14
35 0.15
36 0.14
37 0.1
38 0.1
39 0.11
40 0.11
41 0.12
42 0.13
43 0.11
44 0.14
45 0.15
46 0.16
47 0.15
48 0.15
49 0.14
50 0.12
51 0.14
52 0.13
53 0.15
54 0.15
55 0.2
56 0.23
57 0.29
58 0.3
59 0.35
60 0.37
61 0.43
62 0.46
63 0.45
64 0.45
65 0.47
66 0.49
67 0.46
68 0.46
69 0.39
70 0.37
71 0.35
72 0.34
73 0.26
74 0.23
75 0.22
76 0.2
77 0.19
78 0.2
79 0.18
80 0.19
81 0.21
82 0.25
83 0.22
84 0.24
85 0.23
86 0.27
87 0.27
88 0.24
89 0.23
90 0.21
91 0.2
92 0.18
93 0.15
94 0.1
95 0.11
96 0.11
97 0.1
98 0.08
99 0.07
100 0.08
101 0.08
102 0.08
103 0.06
104 0.08
105 0.1
106 0.1
107 0.1
108 0.1
109 0.1
110 0.09
111 0.1
112 0.08
113 0.08
114 0.12
115 0.17
116 0.28
117 0.37
118 0.42
119 0.45
120 0.5
121 0.55
122 0.59
123 0.64
124 0.62
125 0.62
126 0.61
127 0.61
128 0.63
129 0.65
130 0.62
131 0.56
132 0.49
133 0.4
134 0.4
135 0.37
136 0.32
137 0.27
138 0.27
139 0.32
140 0.38
141 0.41
142 0.44
143 0.51
144 0.59
145 0.67
146 0.73
147 0.75
148 0.78
149 0.86
150 0.89