Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367K5N8

Protein Details
Accession A0A367K5N8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPTKLQPRARPRKTPKMTETRLKRLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.166, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR015898  G-protein_gamma-like_dom  
IPR036284  GGL_sf  
IPR041848  Ste18_fungal  
Gene Ontology GO:0031681  F:G-protein beta-subunit binding  
GO:0007186  P:G protein-coupled receptor signaling pathway  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
Pfam View protein in Pfam  
PF00631  G-gamma  
PROSITE View protein in PROSITE  
PS50058  G_PROTEIN_GAMMA  
Amino Acid Sequences MPTKLQPRARPRKTPKMTETRLKRLEEYNNYLRSQLNISRITVSEASASLIDYCNNNKDPLLPSIWGPVPKNEDPFAPPESGQCCTIIIIEYSINIIYGWSIWINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.85
4 0.84
5 0.83
6 0.82
7 0.81
8 0.79
9 0.71
10 0.65
11 0.6
12 0.62
13 0.59
14 0.58
15 0.55
16 0.52
17 0.5
18 0.48
19 0.43
20 0.35
21 0.32
22 0.27
23 0.26
24 0.23
25 0.24
26 0.24
27 0.24
28 0.25
29 0.21
30 0.18
31 0.12
32 0.11
33 0.11
34 0.09
35 0.09
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.1
42 0.11
43 0.11
44 0.11
45 0.13
46 0.14
47 0.15
48 0.17
49 0.14
50 0.14
51 0.17
52 0.19
53 0.2
54 0.18
55 0.2
56 0.24
57 0.26
58 0.28
59 0.26
60 0.25
61 0.24
62 0.26
63 0.26
64 0.21
65 0.19
66 0.19
67 0.21
68 0.22
69 0.21
70 0.18
71 0.16
72 0.15
73 0.15
74 0.13
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.07
83 0.07
84 0.05
85 0.06
86 0.07