Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JT49

Protein Details
Accession A0A367JT49    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-74MPGIQTFTRRRRWCRRARLVEREIEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
IPR006614  Peroxin/Ferlin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences KQTIKRTTRKVWTWADGDWWVDMTGELEGKVDHNGWEYGNNAWKQLSGMPGIQTFTRRRRWCRRARLVEREIEEIRNNDEAKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.5
3 0.42
4 0.36
5 0.28
6 0.22
7 0.16
8 0.13
9 0.12
10 0.08
11 0.07
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.09
23 0.1
24 0.1
25 0.1
26 0.15
27 0.15
28 0.14
29 0.13
30 0.13
31 0.13
32 0.13
33 0.13
34 0.09
35 0.1
36 0.1
37 0.11
38 0.12
39 0.12
40 0.15
41 0.2
42 0.25
43 0.34
44 0.4
45 0.49
46 0.59
47 0.69
48 0.75
49 0.81
50 0.85
51 0.87
52 0.9
53 0.91
54 0.85
55 0.82
56 0.75
57 0.7
58 0.6
59 0.52
60 0.46
61 0.37
62 0.35
63 0.33
64 0.31
65 0.27