Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367J3Z1

Protein Details
Accession A0A367J3Z1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-126NMTEAEKKKARNKARRAALKAQQEAHydrophilic
NLS Segment(s)
PositionSequence
108-132KKKARNKARRAALKAQQEAEAKKGK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021183  NatA_aux_su  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF12569  NatA_aux_su  
Amino Acid Sequences MQCQWFMVEEGHAYLRKKEYGKALKRFHSIEKIYTDYYDDQFDFHSYCLRKLTLRAYVNALKWEDKNKLNPFYLKAAKGAVDAYLALADKPKTVEQEIDESNMTEAEKKKARNKARRAALKAQQEAEAKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.3
4 0.31
5 0.33
6 0.4
7 0.47
8 0.56
9 0.61
10 0.65
11 0.66
12 0.7
13 0.68
14 0.64
15 0.62
16 0.55
17 0.49
18 0.46
19 0.43
20 0.38
21 0.36
22 0.33
23 0.26
24 0.25
25 0.23
26 0.18
27 0.15
28 0.15
29 0.16
30 0.14
31 0.11
32 0.16
33 0.14
34 0.16
35 0.18
36 0.18
37 0.18
38 0.2
39 0.24
40 0.26
41 0.27
42 0.27
43 0.29
44 0.32
45 0.32
46 0.32
47 0.29
48 0.22
49 0.22
50 0.24
51 0.24
52 0.23
53 0.29
54 0.31
55 0.34
56 0.34
57 0.35
58 0.33
59 0.35
60 0.37
61 0.29
62 0.26
63 0.22
64 0.21
65 0.19
66 0.17
67 0.11
68 0.08
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.07
75 0.07
76 0.07
77 0.1
78 0.11
79 0.13
80 0.14
81 0.16
82 0.16
83 0.22
84 0.22
85 0.22
86 0.21
87 0.19
88 0.18
89 0.16
90 0.15
91 0.14
92 0.15
93 0.2
94 0.25
95 0.31
96 0.39
97 0.48
98 0.59
99 0.65
100 0.73
101 0.76
102 0.82
103 0.85
104 0.85
105 0.85
106 0.82
107 0.82
108 0.77
109 0.69
110 0.64
111 0.59
112 0.54