Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LS04

Protein Details
Accession E2LS04    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
119-146ISGELAKVRQRRKEKRDKEKAAYKKMFAHydrophilic
NLS Segment(s)
PositionSequence
125-143KVRQRRKEKRDKEKAAYKK
Subcellular Location(s) nucl 8.5, mito 7, cyto_nucl 7, cyto 4.5, pero 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
KEGG mpr:MPER_09789  -  
Amino Acid Sequences MENLSRLDKWQKSIRYLDVHREVPESEDSEEVKKSYIALLVPLLLNSALAGVRIQPPTSHNAEIAVASAARALSLELNSADQAKALYRRALAYTILKEDDTAEKDLVEATKLVPDDQAISGELAKVRQRRKEKRDKEKAAYKKMFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.57
4 0.6
5 0.58
6 0.55
7 0.51
8 0.47
9 0.41
10 0.35
11 0.34
12 0.27
13 0.21
14 0.2
15 0.2
16 0.2
17 0.21
18 0.18
19 0.16
20 0.14
21 0.13
22 0.12
23 0.12
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.07
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.09
40 0.1
41 0.1
42 0.1
43 0.12
44 0.16
45 0.2
46 0.19
47 0.16
48 0.16
49 0.16
50 0.15
51 0.14
52 0.1
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.03
60 0.04
61 0.04
62 0.05
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.05
69 0.06
70 0.07
71 0.09
72 0.1
73 0.12
74 0.12
75 0.13
76 0.14
77 0.15
78 0.15
79 0.16
80 0.16
81 0.17
82 0.17
83 0.16
84 0.15
85 0.16
86 0.17
87 0.17
88 0.17
89 0.15
90 0.14
91 0.14
92 0.15
93 0.14
94 0.11
95 0.08
96 0.07
97 0.1
98 0.1
99 0.1
100 0.1
101 0.1
102 0.11
103 0.11
104 0.12
105 0.1
106 0.1
107 0.1
108 0.12
109 0.12
110 0.13
111 0.18
112 0.24
113 0.3
114 0.39
115 0.5
116 0.59
117 0.69
118 0.78
119 0.83
120 0.88
121 0.92
122 0.93
123 0.92
124 0.92
125 0.91
126 0.91