Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367INZ2

Protein Details
Accession A0A367INZ2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
6-35SAQYFYRTGKCNKRREKRSQSLPKLCRPGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences STPRRSAQYFYRTGKCNKRREKRSQSLPKLCRPGKNLEGRQAIAGVRLLFLNENEEQEGTSSSESVLEMGEGWENDAWRLENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.72
4 0.75
5 0.79
6 0.82
7 0.87
8 0.9
9 0.89
10 0.91
11 0.92
12 0.91
13 0.91
14 0.87
15 0.84
16 0.83
17 0.76
18 0.7
19 0.63
20 0.6
21 0.57
22 0.61
23 0.56
24 0.54
25 0.53
26 0.48
27 0.44
28 0.37
29 0.29
30 0.2
31 0.18
32 0.1
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.09
39 0.09
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.11
46 0.09
47 0.09
48 0.08
49 0.07
50 0.08
51 0.08
52 0.07
53 0.06
54 0.05
55 0.05
56 0.06
57 0.08
58 0.07
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12