Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JS16

Protein Details
Accession A0A367JS16    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-44GLSTKGNKTKLKERLKKAKKEAKEVKKEEEEBasic
241-260GCIFKANCKLQKRQGNRKSRHydrophilic
NLS Segment(s)
PositionSequence
19-40GNKTKLKERLKKAKKEAKEVKK
Subcellular Location(s) nucl 11, cyto_nucl 11, cyto 9, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR047201  ERI-1_3'hExo-like  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0031047  P:RNA-mediated gene silencing  
Pfam View protein in Pfam  
PF00929  RNase_T  
PF02037  SAP  
PROSITE View protein in PROSITE  
PS50800  SAP  
CDD cd06133  ERI-1_3'hExo_like  
Amino Acid Sequences MKVEELRLALEQLGLSTKGNKTKLKERLKKAKKEAKEVKKEEEEEEPKINKQPFDYYLFFDVEATCIENGGFKYANEIIEFPVVLVDGKTFEIVDEFRSYVKPTINPTLSEFCMKLTGISQDTVDNSPIFIDVLNQFQEFLAKYNLFQSSSAVFVTDGPFDIRDFITKQLEHSNIDPRPAYFTLPWINIRKLFKDFYHQTQNKNINGMLEHLNMSFKGREHSGLDDARNLAYIAKRMHEEGCIFKANCKLQKRQGNRKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.16
4 0.2
5 0.26
6 0.33
7 0.37
8 0.41
9 0.5
10 0.6
11 0.66
12 0.72
13 0.75
14 0.81
15 0.85
16 0.89
17 0.91
18 0.9
19 0.86
20 0.88
21 0.88
22 0.87
23 0.88
24 0.83
25 0.8
26 0.78
27 0.73
28 0.65
29 0.64
30 0.57
31 0.5
32 0.52
33 0.46
34 0.4
35 0.44
36 0.45
37 0.36
38 0.35
39 0.36
40 0.33
41 0.37
42 0.37
43 0.33
44 0.33
45 0.32
46 0.29
47 0.24
48 0.2
49 0.15
50 0.13
51 0.11
52 0.08
53 0.07
54 0.07
55 0.09
56 0.09
57 0.11
58 0.11
59 0.09
60 0.14
61 0.15
62 0.16
63 0.14
64 0.15
65 0.13
66 0.13
67 0.13
68 0.09
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.06
80 0.07
81 0.08
82 0.09
83 0.09
84 0.1
85 0.11
86 0.12
87 0.14
88 0.16
89 0.16
90 0.19
91 0.26
92 0.26
93 0.27
94 0.28
95 0.29
96 0.28
97 0.27
98 0.23
99 0.16
100 0.16
101 0.15
102 0.12
103 0.09
104 0.11
105 0.1
106 0.1
107 0.1
108 0.1
109 0.11
110 0.12
111 0.12
112 0.09
113 0.08
114 0.08
115 0.07
116 0.06
117 0.05
118 0.06
119 0.05
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.09
126 0.08
127 0.09
128 0.1
129 0.09
130 0.09
131 0.12
132 0.13
133 0.13
134 0.13
135 0.13
136 0.11
137 0.12
138 0.11
139 0.09
140 0.08
141 0.08
142 0.09
143 0.08
144 0.07
145 0.07
146 0.08
147 0.07
148 0.09
149 0.08
150 0.09
151 0.1
152 0.13
153 0.16
154 0.16
155 0.18
156 0.22
157 0.24
158 0.24
159 0.25
160 0.3
161 0.27
162 0.29
163 0.28
164 0.22
165 0.26
166 0.25
167 0.25
168 0.17
169 0.21
170 0.23
171 0.25
172 0.3
173 0.29
174 0.31
175 0.34
176 0.36
177 0.35
178 0.35
179 0.36
180 0.32
181 0.37
182 0.39
183 0.4
184 0.49
185 0.49
186 0.49
187 0.55
188 0.61
189 0.53
190 0.51
191 0.45
192 0.35
193 0.33
194 0.32
195 0.26
196 0.2
197 0.19
198 0.17
199 0.17
200 0.16
201 0.18
202 0.16
203 0.14
204 0.16
205 0.16
206 0.19
207 0.2
208 0.24
209 0.27
210 0.29
211 0.3
212 0.3
213 0.29
214 0.26
215 0.24
216 0.21
217 0.17
218 0.16
219 0.2
220 0.19
221 0.2
222 0.22
223 0.24
224 0.25
225 0.26
226 0.27
227 0.27
228 0.3
229 0.35
230 0.33
231 0.35
232 0.42
233 0.46
234 0.51
235 0.53
236 0.57
237 0.59
238 0.7
239 0.76
240 0.8