Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367IP75

Protein Details
Accession A0A367IP75    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-125KDMTKVDTKKDTKKDTKKDTKKITKKDTKKDQEBasic
NLS Segment(s)
PositionSequence
84-122KNNSKKIVKKDMTKVDTKKDTKKDTKKDTKKITKKDTKK
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 11, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51194  HELICASE_CTER  
CDD cd18787  SF2_C_DEAD  
Amino Acid Sequences MARGLDFKGVNLVINYDFPQSVASYIHRIGRTGRAGRAGEAVTYYTQEDFPYLKKVVNVMKESGCDVPDWMLKSAKQAAKQAVKNNSKKIVKKDMTKVDTKKDTKKDTKKDTKKITKKDTKKDQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.14
4 0.14
5 0.13
6 0.14
7 0.12
8 0.12
9 0.12
10 0.13
11 0.14
12 0.17
13 0.22
14 0.21
15 0.21
16 0.23
17 0.28
18 0.33
19 0.33
20 0.33
21 0.33
22 0.34
23 0.33
24 0.34
25 0.27
26 0.2
27 0.17
28 0.16
29 0.1
30 0.11
31 0.1
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.1
38 0.13
39 0.14
40 0.14
41 0.14
42 0.17
43 0.2
44 0.24
45 0.24
46 0.22
47 0.22
48 0.21
49 0.23
50 0.2
51 0.16
52 0.11
53 0.1
54 0.09
55 0.1
56 0.12
57 0.12
58 0.12
59 0.12
60 0.15
61 0.22
62 0.23
63 0.24
64 0.27
65 0.32
66 0.39
67 0.43
68 0.47
69 0.5
70 0.57
71 0.59
72 0.61
73 0.63
74 0.62
75 0.63
76 0.64
77 0.65
78 0.62
79 0.65
80 0.68
81 0.69
82 0.67
83 0.7
84 0.67
85 0.65
86 0.69
87 0.67
88 0.67
89 0.66
90 0.71
91 0.74
92 0.8
93 0.81
94 0.83
95 0.88
96 0.89
97 0.91
98 0.92
99 0.92
100 0.92
101 0.92
102 0.92
103 0.92
104 0.92
105 0.92