Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367KGN6

Protein Details
Accession A0A367KGN6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49RLKNDRKTFMKEKKQPDLNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR003789  Asn/Gln_tRNA_amidoTrase-B-like  
IPR023168  GatB_Yqey_C_2  
IPR019004  YqeY/Aim41  
IPR042184  YqeY/Aim41_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016884  F:carbon-nitrogen ligase activity, with glutamine as amido-N-donor  
Pfam View protein in Pfam  
PF09424  YqeY  
Amino Acid Sequences MSMIARSIRPFTIVNRFYTTAAASESIVARLKNDRKTFMKEKKQPDLNVLKGLLSDFTYYTKSPSFKEGTSEDEAMMSVLQKAIKRRQDSIEQFKSGGRPELAEQELQELKVLESYLPEQMSAEAIEKEVKSLIEQLGATSAKDMGKVMKAWKYDSAVADRKLVSDAVKKLLSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.4
4 0.37
5 0.37
6 0.33
7 0.23
8 0.22
9 0.19
10 0.13
11 0.13
12 0.13
13 0.14
14 0.15
15 0.14
16 0.14
17 0.22
18 0.28
19 0.35
20 0.38
21 0.43
22 0.46
23 0.54
24 0.63
25 0.65
26 0.69
27 0.69
28 0.74
29 0.77
30 0.8
31 0.73
32 0.71
33 0.69
34 0.61
35 0.56
36 0.48
37 0.38
38 0.31
39 0.29
40 0.21
41 0.14
42 0.11
43 0.08
44 0.09
45 0.11
46 0.11
47 0.13
48 0.16
49 0.17
50 0.17
51 0.21
52 0.23
53 0.21
54 0.24
55 0.23
56 0.25
57 0.27
58 0.27
59 0.21
60 0.19
61 0.18
62 0.14
63 0.13
64 0.08
65 0.04
66 0.05
67 0.06
68 0.08
69 0.12
70 0.19
71 0.25
72 0.27
73 0.3
74 0.33
75 0.4
76 0.46
77 0.51
78 0.49
79 0.44
80 0.42
81 0.4
82 0.39
83 0.31
84 0.26
85 0.16
86 0.13
87 0.13
88 0.17
89 0.17
90 0.16
91 0.15
92 0.16
93 0.17
94 0.15
95 0.15
96 0.1
97 0.09
98 0.1
99 0.1
100 0.06
101 0.07
102 0.08
103 0.1
104 0.1
105 0.1
106 0.09
107 0.09
108 0.1
109 0.09
110 0.1
111 0.07
112 0.08
113 0.1
114 0.1
115 0.1
116 0.11
117 0.1
118 0.1
119 0.12
120 0.12
121 0.12
122 0.12
123 0.12
124 0.15
125 0.15
126 0.14
127 0.12
128 0.14
129 0.12
130 0.12
131 0.13
132 0.11
133 0.14
134 0.17
135 0.21
136 0.25
137 0.26
138 0.29
139 0.33
140 0.34
141 0.35
142 0.36
143 0.39
144 0.41
145 0.41
146 0.42
147 0.38
148 0.35
149 0.32
150 0.3
151 0.25
152 0.26
153 0.27
154 0.29