Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367K6L6

Protein Details
Accession A0A367K6L6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-44YNELKKEGSSKKPKPKLSRKRKAGGSKEPSBasic
NLS Segment(s)
PositionSequence
19-51KKEGSSKKPKPKLSRKRKAGGSKEPSGSRKRAR
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MTASLNTWIKSLRSYNELKKEGSSKKPKPKLSRKRKAGGSKEPSGSRKRARSNVSDFASSSAAQPVPVPPSQPSAAAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.48
4 0.5
5 0.47
6 0.46
7 0.51
8 0.52
9 0.55
10 0.58
11 0.58
12 0.66
13 0.74
14 0.79
15 0.81
16 0.86
17 0.87
18 0.88
19 0.89
20 0.86
21 0.85
22 0.85
23 0.85
24 0.81
25 0.81
26 0.76
27 0.7
28 0.65
29 0.61
30 0.57
31 0.52
32 0.5
33 0.47
34 0.48
35 0.51
36 0.54
37 0.56
38 0.59
39 0.61
40 0.63
41 0.59
42 0.52
43 0.45
44 0.4
45 0.37
46 0.29
47 0.23
48 0.18
49 0.15
50 0.14
51 0.14
52 0.14
53 0.17
54 0.17
55 0.19
56 0.17
57 0.23
58 0.24