Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367JL32

Protein Details
Accession A0A367JL32    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
147-175DKVETVQEAKPNKKKKKNNKKKKTALTVEHydrophilic
NLS Segment(s)
PositionSequence
156-169KPNKKKKKNNKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.833, mito_nucl 11.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR001678  MeTrfase_RsmB/NOP2  
IPR023267  RCMT  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008173  F:RNA methyltransferase activity  
GO:0008757  F:S-adenosylmethionine-dependent methyltransferase activity  
Pfam View protein in Pfam  
PF01189  Methyltr_RsmB-F  
PROSITE View protein in PROSITE  
PS51686  SAM_MT_RSMB_NOP  
Amino Acid Sequences GKQDVKVNITPIHGSFLEADPNDPQYSQVEYLLLDPSCSGSGIISRLDHLVDDEDENEGSSDKNGSTQEERLKNLSEFQISVIEHALKFPNAKRVVYSTCSVHAEENEHVVKTVLKNNPEFELASRDTVLPTWHRRGMPKEMDGDEDKVETVQEAKPNKKKKKNNKKKKTALTVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.23
5 0.21
6 0.22
7 0.19
8 0.22
9 0.21
10 0.19
11 0.19
12 0.15
13 0.18
14 0.18
15 0.17
16 0.14
17 0.14
18 0.15
19 0.17
20 0.15
21 0.12
22 0.1
23 0.11
24 0.11
25 0.11
26 0.1
27 0.06
28 0.08
29 0.09
30 0.11
31 0.1
32 0.1
33 0.1
34 0.11
35 0.1
36 0.09
37 0.1
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.09
52 0.11
53 0.14
54 0.18
55 0.25
56 0.28
57 0.29
58 0.29
59 0.3
60 0.28
61 0.28
62 0.25
63 0.18
64 0.15
65 0.14
66 0.15
67 0.13
68 0.13
69 0.12
70 0.11
71 0.1
72 0.1
73 0.1
74 0.07
75 0.09
76 0.1
77 0.17
78 0.18
79 0.19
80 0.19
81 0.22
82 0.24
83 0.25
84 0.26
85 0.19
86 0.2
87 0.21
88 0.21
89 0.18
90 0.16
91 0.16
92 0.15
93 0.17
94 0.16
95 0.14
96 0.14
97 0.13
98 0.14
99 0.13
100 0.2
101 0.2
102 0.22
103 0.24
104 0.26
105 0.27
106 0.27
107 0.26
108 0.2
109 0.22
110 0.2
111 0.2
112 0.19
113 0.17
114 0.16
115 0.16
116 0.18
117 0.17
118 0.22
119 0.27
120 0.31
121 0.33
122 0.38
123 0.43
124 0.49
125 0.5
126 0.47
127 0.47
128 0.44
129 0.46
130 0.44
131 0.4
132 0.32
133 0.26
134 0.22
135 0.17
136 0.16
137 0.11
138 0.11
139 0.12
140 0.17
141 0.24
142 0.33
143 0.43
144 0.53
145 0.64
146 0.72
147 0.8
148 0.85
149 0.9
150 0.92
151 0.94
152 0.95
153 0.96
154 0.96
155 0.96